Reactivity | HuSpecies Glossary |
Applications | IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PYY |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-80865 | Applications | Species |
---|---|---|
Olivieri, M, M Charting the genetic architecture of the DNA damage response in human cells Thesis 2022-01-01 (WB, Human) | WB | Human |
Das S, Parray H, Chiranjivi A et al. Kennedy epitope (KE)-dependent retrograde transport of efficiently cleaved HIV-1 envelopes (Envs) and its effect on Env cell surface expression and viral particle formation Research Square 2022-11-10 (WB, Human) | WB | Human |
Gurrado A, Giungato S, Catacchio I et al. Jejunal overexpression of peptide YY in celiac disease complicated with pneumatosis cystoides intestinalis. Clin. Exp. Med. 2014-10-08 [PMID: 25291987] |
Secondary Antibodies |
Isotype Controls |
Diseases for Peptide YY Antibody (NBP1-80865)Discover more about diseases related to Peptide YY Antibody (NBP1-80865).
| Pathways for Peptide YY Antibody (NBP1-80865)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.