Peptide YY Antibody - BSA Free

Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Analysis in human colon and liver tissues using NBP1-80865 antibody. Corresponding Peptide YY RNA-seq data are presented for the same tissues.

Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.

Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.

Staining of human tonsil shows no positivity as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Peptide YY Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Peptide YY Antibody - BSA Free (NBP1-80865) is a polyclonal antibody validated for use in IHC and WB. Anti-Peptide YY Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PYY
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Peptide YY Protein (NBP1-80865PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Peptide YY Antibody - BSA Free

• Peptide tyrosine tyrosine
• Peptide YY
• Peptide-YY
• PYY
• PYY1
• PYY-I

Background

This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Peptide YY Antibody (NBP1-80865)(3)

Publications using NBP1-80865

• Olivieri, M, M Charting the genetic architecture of the DNA damage response in human cells Thesis 2022-01-01 (WB, Human)
• Das S, Parray H, Chiranjivi A et al. Kennedy epitope (KE)-dependent retrograde transport of efficiently cleaved HIV-1 envelopes (Envs) and its effect on Env cell surface expression and viral particle formation Research Square 2022-11-10 (WB, Human)
• Gurrado A, Giungato S, Catacchio I et al. Jejunal overexpression of peptide YY in celiac disease complicated with pneumatosis cystoides intestinalis. Clin. Exp. Med. 2014-10-08 [PMID: 25291987]

Bioinformatics

• Gene Symbol: PYY
• Entrez:
  • 5697(Human)
• Uniprot:
  • P10082()
  • P10082()
  • P10082()
  • P10082()