Peptide YY Antibody

Images

 
Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining in human rectum and liver tissues using anti-PYY antibody. Corresponding PYY RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Peptide YY Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Specificity
Specificity of human Peptide YY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Peptide YY Protein (NBP1-80865PEP)
Publications
Read Publication using NBP1-80865.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peptide YY Antibody

  • Peptide tyrosine tyrosine
  • Peptide YY
  • Peptide-YY
  • PYY
  • PYY1
  • PYY-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-60645
Species: Hu
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-32424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
MAB8864
Species: Hu
Applications: IHC
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-80865
Species: Hu
Applications: IHC, IHC-P

Publications for Peptide YY Antibody (NBP1-80865)(1)

Reviews for Peptide YY Antibody (NBP1-80865) (0)

There are no reviews for Peptide YY Antibody (NBP1-80865). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Peptide YY Antibody (NBP1-80865) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Peptide YY Antibody (NBP1-80865)

Discover related pathways, diseases and genes to Peptide YY Antibody (NBP1-80865). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peptide YY Antibody (NBP1-80865)

Discover more about diseases related to Peptide YY Antibody (NBP1-80865).
 

Pathways for Peptide YY Antibody (NBP1-80865)

View related products by pathway.

PTMs for Peptide YY Antibody (NBP1-80865)

Learn more about PTMs related to Peptide YY Antibody (NBP1-80865).
 

Research Areas for Peptide YY Antibody (NBP1-80865)

Find related products by research area.

Blogs on Peptide YY

There are no specific blogs for Peptide YY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peptide YY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYY
Entrez