GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free

Western Blot: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Analysis in control (vector only transfected HEK293T lysate) and GFRA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GFR alpha-3/GDNF R alpha-3 Antibody [NBP1-89774] - Staining of human lung shows strong membranous positivity in pneumocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFRA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free

• GDNF family receptor alpha 3
• GDNF family receptor alpha-3
• GDNF R alpha-3
• GDNF receptor alpha-3
• GDNFR-alpha-3
• GFR alpha3
• GFR alpha-3
• GFRA3
• GFRa-3
• GFR-alpha-3
• glial cell line-derived neurotrophic factor receptor alpha-3
• GPI-linked receptor

Background

Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuronal survival and differentiation. A new member of the GDNF family was recently identified and designated persephin. Physiological responses to these neurotrophic factors require two receptor subunits, the novel glycosylphosphatidylinositol linked protein GFRalpha and Ret receptor tyrosine kinase GFRbeta. Following the identification of GFRalpha-1 and 2, another receptor in the GFR family was identified in human and mouse and designated GFRalpha-3. GFRalpha-3 binds persephin. Thus, persephin, GFRalpha-3, and Ret PTK form a complex to transmit the persephin signal and to mediate persephin function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFRA3
• Entrez:
  • 2676(Human)
• Uniprot:
  • O60609()