GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free (NBP1-89774) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GFRA3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Theoretical MW |
44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GFR alpha-3/GDNF R alpha-3 Antibody - BSA Free
Background
Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuronal survival and differentiation. A new member of the GDNF family was recently identified and designated persephin. Physiological responses to these neurotrophic factors require two receptor subunits, the novel glycosylphosphatidylinositol linked protein GFRalpha and Ret receptor tyrosine kinase GFRbeta. Following the identification of GFRalpha-1 and 2, another receptor in the GFR family was identified in human and mouse and designated GFRalpha-3. GFRalpha-3 binds persephin. Thus, persephin, GFRalpha-3, and Ret PTK form a complex to transmit the persephin signal and to mediate persephin function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Bind, BA
Species: Rt
Applications: Block, IHC, WB
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774) (0)
There are no publications for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774) (0)
There are no reviews for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GFR alpha-3/GDNF R alpha-3 Products
Research Areas for GFR alpha-3/GDNF R alpha-3 Antibody (NBP1-89774)
Find related products by research area.
|
Blogs on GFR alpha-3/GDNF R alpha-3