Geminin Antibody


Immunocytochemistry/ Immunofluorescence: Geminin Antibody [NBP2-14058] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: Geminin Antibody [NBP2-14058] - Staining in human testis and skeletal muscle tissues using anti-GMNN antibody. Corresponding GMNN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Geminin Antibody [NBP2-14058] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Geminin Antibody [NBP2-14058] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Geminin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELI ERLNGEPLDN
Specificity of human Geminin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Geminin Protein (NBP2-14058PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Geminin Antibody

  • Gem
  • geminin
  • geminin, DNA replication inhibitor
  • RP3-369A17.3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IP
Species: Hu
Applications: IHC
Species: Hu
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Geminin Antibody (NBP2-14058) (0)

There are no publications for Geminin Antibody (NBP2-14058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Geminin Antibody (NBP2-14058) (0)

There are no reviews for Geminin Antibody (NBP2-14058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Geminin Antibody (NBP2-14058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Geminin Products

Bioinformatics Tool for Geminin Antibody (NBP2-14058)

Discover related pathways, diseases and genes to Geminin Antibody (NBP2-14058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Geminin Antibody (NBP2-14058)

Discover more about diseases related to Geminin Antibody (NBP2-14058).

Pathways for Geminin Antibody (NBP2-14058)

View related products by pathway.

PTMs for Geminin Antibody (NBP2-14058)

Learn more about PTMs related to Geminin Antibody (NBP2-14058).

Research Areas for Geminin Antibody (NBP2-14058)

Find related products by research area.

Blogs on Geminin

There are no specific blogs for Geminin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Geminin Antibody and receive a gift card or discount.


Gene Symbol GMNN