GDF-15 Antibody

Images

 
Genetic Strategies: Western Blot: GDF-15 Antibody [NBP1-81050] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GDF15 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: GDF-15 Antibody [NBP1-81050] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human placenta shows very strong cytoplasmic positivity in trophoblastic cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Analysis in human placenta and testis tissues. Corresponding GDF15 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human prostate shows moderate cytoplasmic positivity in a small subset of glandular cells.
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDF-15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Specificity
Specificity of human GDF-15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
IHC reported in scientific literature (PMID: 25730371). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB and IP reported in the literature.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Publications
Read Publications using
NBP1-81050 in the following applications:

  • IHC
    3 publications
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25730371).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDF-15 Antibody

  • GDF15
  • GDF-15
  • growth differentiation factor 15
  • growth/differentiation factor 15
  • Macrophage inhibitory cytokine 1
  • MIC-1
  • MIC-1NSAID-activated gene 1 protein
  • MIC1Prostate differentiation factor
  • NAG-1
  • NAG-1NSAID-regulated gene 1 protein
  • NSAID (nonsteroidal inflammatory drug)-activated protein 1
  • PDF
  • PDFGDF-15
  • PLAB
  • PLABNRG-1
  • Placental bone morphogenetic protein
  • Placental TGF-beta
  • PTGF-beta
  • PTGFBPTGF-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
7270-IL/CF
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59337
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85816
Species: Hu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-81050
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for GDF-15 Antibody (NBP1-81050)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: IHC, IP, WB.


Filter By Application
IHC
(3)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-81050 Applications Species
Uchiyama T, Kawabata H, Miura Y et al. The role of growth differentiation factor 15 in the pathogenesis of primary myelofibrosis. Cancer Med 2015 Oct [PMID: 26276681] (IHC, Human) IHC Human
Lee J, Fricke F, Warnken U et al. Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells. PLoS One 2015 [PMID: 26114631] (IP, WB) IP, WB
Liu X, Chi X, Gong Q et al. Association of Serum Level of Growth Differentiation Factor 15 with Liver Cirrhosis and Hepatocellular Carcinoma. PLoS One 2015 [PMID: 25996938] (IHC, Human) IHC Human
Naoki Urakawa, Soken Utsunomiya, Mari Nishio et al. GDF15 derived from both tumor-associated macrophages and esophageal squamous cell carcinomas contributes to tumor progression via Akt and Erk pathways. Laboratory Investigation 2015 Mar 02 [PMID: 25730371] (IHC, Human) IHC Human
Nickel N, Jonigk D, Kempf T et al. GDF-15 is abundantly expressed in plexiform lesions in patients with pulmonary arterial hypertension and affects proliferation and apoptosis of pulmonary endothelial cells. Respir Res. 2011 May [PMID: 21548946]
Wallin U, Glimelius B, Jirstrom K et al. Growth differentiation factor 15: a prognostic marker for recurrence in colorectal cancer. Br J Cancer. 2011 May [PMID: 21468045]
Roth P, Junker M, Tritschler I et al. GDF-15 contributes to proliferation and immune escape of malignant gliomas. Clin Cancer Res. 2010 Aug. [PMID: 20534737]
Tabrizi AD, Kalloger SE, Kobel M et al. Primary ovarian mucinous carcinoma of intestinal type: significance of pattern of invasion and immunohistochemical expression profile in a series of 31 cases. Int J Gynecol Pathol. 2010 Mar. [PMID: 20173494]

Reviews for GDF-15 Antibody (NBP1-81050) (0)

There are no reviews for GDF-15 Antibody (NBP1-81050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GDF-15 Antibody (NBP1-81050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDF-15 Products

Bioinformatics Tool for GDF-15 Antibody (NBP1-81050)

Discover related pathways, diseases and genes to GDF-15 Antibody (NBP1-81050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-15 Antibody (NBP1-81050)

Discover more about diseases related to GDF-15 Antibody (NBP1-81050).
 

Pathways for GDF-15 Antibody (NBP1-81050)

View related products by pathway.

PTMs for GDF-15 Antibody (NBP1-81050)

Learn more about PTMs related to GDF-15 Antibody (NBP1-81050).

Blogs on GDF-15

There are no specific blogs for GDF-15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF15
Entrez
Uniprot