ATF3 Antibody

Images

 
Genetic Strategies: Knockout Validated: ATF3 Antibody [NBP1-85816] - HeLa human cervical epithelial carcinoma parental cell line lysate and ATF3 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.1 ...read more
Western Blot: ATF3 Antibody [NBP1-85816] - HDLM-2 and Daudi cell lysates. PVDF membrane was probed with 0.1 ug/mL of Rabbit Anti-Human ATF3 Polyclonal Antibody (Catalog # NBP1-85816) followed by HRP-conjugated ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was ...read more
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.

Product Details

Summary
Reactivity Hu, Fe, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ATF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Specificity
Specificity of human ATF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockout Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 24939851).
Control
ATF3 Lysate (NBP2-64807)
Control Peptide
ATF3 Protein (NBP1-85816PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-85816 in the following applications:

Publications
Read Publications using
NBP1-85816 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21266251)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF3 Antibody

  • activating transcription factor 3cAMP-dependent transcription factor ATF-3
  • ATF3deltaZip2
  • ATF3deltaZip2c
  • ATF3deltaZip3
  • cyclic AMP-dependent transcription factor ATF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
7270-IL/CF
Species: Hu
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB100-56594
Species: Hu
Applications: WB, Flow
NBP2-67766
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56530
Species: Hu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
8146-GD/CF
Species: Hu

Publications for ATF3 Antibody (NBP1-85816)(5)

Reviews for ATF3 Antibody (NBP1-85816) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Rat, Feline.

Reviews using NBP1-85816:
Filter by Applications
IHC-Fr
(2)
All Applications
Filter by Species
Rat
(1)
Feline
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen ATF3 NBP1-85816
Enlarge
reviewed by:
Anonymous
IHC-Fr Feline 10/19/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedOptic nerve
SpeciesFeline
LotB114876
Immunohistochemistry-Frozen ATF3 NBP1-85816
Enlarge
reviewed by:
Joanne Steinauer
IHC-Fr Rat 09/15/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedDorsal root ganglion
SpeciesRat
LotB106628

Comments

CommentsFixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATF3 Antibody (NBP1-85816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ATF3 Antibody (NBP1-85816)

Discover related pathways, diseases and genes to ATF3 Antibody (NBP1-85816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF3 Antibody (NBP1-85816)

Discover more about diseases related to ATF3 Antibody (NBP1-85816).
 

Pathways for ATF3 Antibody (NBP1-85816)

View related products by pathway.

PTMs for ATF3 Antibody (NBP1-85816)

Learn more about PTMs related to ATF3 Antibody (NBP1-85816).
 

Research Areas for ATF3 Antibody (NBP1-85816)

Find related products by research area.

Blogs on ATF3.

Chemotherapy-induced metastasis: An unexpected foe?
By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che...  Read full blog post.

Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State
MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
10/19/2018
Application: IHC-Fr
Species: Feline

Joanne Steinauer
09/15/2017
Application: IHC-Fr
Species: Rat

Bioinformatics

Gene Symbol ATF3