ATF3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.

Staining of mouse dorsal root ganglion shows strong nuclear immunoreactivity in single neurons.

Staining of human skeletal muscle shows very weak nucleus-cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATF3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATF3 Protein (NBP1-85816PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATF3 Antibody - BSA Free

• activating transcription factor 3cAMP-dependent transcription factor ATF-3
• ATF3deltaZip2
• ATF3deltaZip2c
• ATF3deltaZip3
• cyclic AMP-dependent transcription factor ATF-3

Background

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATF3 Antibody (NBP1-85816)(38)

Publications using NBP1-85816

• Hu S, Cassim Bawa FN, Zhu Y et al. Loss of adipose ATF3 promotes adipose tissue lipolysis and the development of MASH Communications Biology 2024-10-10 [PMID: 39390075]
• Deininger S, Schumacher J, Blechschmidt A et al. Nerve injury converts Schwann cells in a long-term repair-like state in human neuroma tissue. Experimental neurology 2024-10-01 [PMID: 39362479]
• Cooper AH, Barry AM, Chrysostomidou P et Al. Peripheral nerve injury results in a biased loss of sensory neuron subpopulations Pain 2024-12-01 [PMID: 39158319]
• Contreras-Panta, EW;Lee, SH;Won, Y;Norlander, AE;Simmons, AJ;Peebles, RS;Lau, KS;Choi, E;Goldenring, JR; INTERLEUKIN 13 PROMOTES MATURATION AND PROLIFERATION IN METAPLASTIC GASTROIDS Cellular and molecular gastroenterology and hepatology 2024-05-28 [PMID: 38815928]
• Jonathan Z. Pan, Zhanqiang Wang, Wei Sun, Peipei Pan, Wei Li, Yongtao Sun, Shoulin Chen, Amity Lin, Wulin Tan, Liangliang He, Jacob Greene, Virginia Yao, Lijun An, Rich Liang, Qifeng Li, Jessica Yu, Lingyi Zhang, Nikolaos Kyritsis, Xuan Duong Fernandez, Sara Moncivais, Esmeralda Mendoza, Pamela Fung, Gongming Wang, Xinhuan Niu, Qihang Du, Zhaoyang Xiao, Yuwen Chang, Peiyuan Lv, J. Russell Huie, Abel Torres‐Espin, Adam R. Ferguson, Debra D. Hemmerle, Jason F. Talbott, Philip R. Weinstein, Lisa U. Pascual, Vineeta Singh, Anthony M. DiGiorgio, Rajiv Saigal, William D. Whetstone, Geoffrey T. Manley, Sanjay S. Dhall, Jacqueline C. Bresnahan, Mervyn Maze, Xiangning Jiang, Neel S. Singhal, Michael S. Beattie, Hua Su, Zhonghui Guan ATF3 is a neuron‐specific biomarker for spinal cord injury and ischaemic stroke Clinical and Translational Medicine 2024-04-22 [PMID: 38649772]
• Miao ZF, Sun JX, Huang XZ, Bai S et Al. Metaplastic regeneration in the mouse stomach requires a reactive oxygen species pathway Dev Cell 2024-03-23 [PMID: 38521055]
• Asghari Adib E, Shadrach JL, Reilly-Jankowiak L et Al. DLK signaling in axotomized neurons triggers complement activation and loss of upstream synapses Cell Rep 2024-03-07 [PMID: 38363678]
• Lou Y, Song F, Kang Y, Xu Y Periodic Mechanical Stress Inhibits the Development of Osteoarthritis via Regulating ATF3-Akt Axis Journal of inflammation research 2023-11-28 [PMID: 38046403]
• Wang HC, Cheng KI, Tseng KY et al. AAV-glycine receptor ?3 alleviates CFA-induced inflammatory pain by downregulating ERK phosphorylation and proinflammatory cytokine expression in SD rats Molecular medicine (Cambridge, Mass.) 2023-02-15 [PMID: 36792984] (Immunohistochemistry, Western Blot)
• Konopleva M, Yap T, Daver N et al. Targeting Oxidative Phosphorylation with a Mitochondrial Complex I Inhibitor is limited by Mechanism-based Toxicity Research Square (IHC-Fr, Mouse)
• Dang I, Brazzo JA, Bae Y, Assoian RK Key role for Rac in the early transcriptional response to ECM stiffness and the stiffness-dependent repression of ATF3 Journal of cell science 2023-09-22 [PMID: 37737020] (WB, Mouse)
• Feng R, Muraleedharan Saraswathy V, Mokalled MH, Cavalli V. Self-renewing macrophages in dorsal root ganglia contribute to promote nerve regeneration Proceedings of the National Academy of Sciences 2023-02-14 [PMID: 36763532]
• Yap TA, Daver N, Mahendra M et al. Complex I inhibitor of oxidative phosphorylation in advanced solid tumors and acute myeloid leukemia: phase I trials Nature medicine 2023-01-01 [PMID: 36658425] (IHC-P, Mouse)
  
  Details:
  Dilution used 1:500
• Cervia L, Shibue T, Borah A et al. Data from A Ubiquitination Cascade Regulating the Integrated Stress Response and Survival in Carcinomas American Association for Cancer Research 2023-04-04 [PMID: 36576405]
• James NE, Woodman M, De La Cruz P et al. Adaptive transcriptomic and immune infiltrate responses in the tumor immune microenvironment following neoadjuvant chemotherapy in high grade serous ovarian cancer reveal novel prognostic associations and activation of pro-tumorigenic pathways Frontiers in Immunology 2022-09-05 [PMID: 36131935]
• M Balogh, J Zhang, CM Gaffney, N Kalakuntla, NT Nguyen, RT Trinh, C Aguilar, HV Pham, B Milutinovi, JM Nichols, R Mahalingam, AJ Shepherd Sensory neuron dysfunction in orthotopic mouse models of colon cancer Journal of Neuroinflammation, 2022-08-12;19(1):204. 2022-08-12 [PMID: 35962398]
• Perez-Sanchez J, Middleton S, Pattison L et al. Inhibition of sensory neuron driven acute, inflammatory, and neuropathic pain using a humanised chemogenetic system bioRxiv 2023-03-22
• E Serger, L Luengo-Gut, JS Chadwick, G Kong, L Zhou, G Crawford, MC Danzi, A Myridakis, A Brandis, AT Bello, F Müller, A Sanchez-Va, F De Virgili, P Liddell, ME Dumas, J Strid, S Mani, D Dodd, S Di Giovann The gut metabolite indole-3 propionate promotes nerve regeneration and repair Nature, 2022-06-22;0(0):. 2022-06-22 [PMID: 35732737]
• Palazzo I, Todd LJ, Hoang TV et al. NFkB-signaling promotes glial reactivity and suppresses M�ller glia-mediated neuron regeneration in the mammalian retina Glia 2022-07-01 [PMID: 35388544]
• Ying Wang, Hua Gao, Fudi Wang, Zhongde Ye, Michal Mokry, Adam W Turner, Jianqin Ye, Simon Koplev, Lingfeng Luo, Tom Alsaigh, Shaunak S Adkar, Maria Elishaev, Xiangyu Gao, Lars Maegdefessel, Johan L M Björkegren, Gerard Pasterkamp, Clint L Miller, Elsie G Ross, Nicholas J Leeper Dynamic changes in chromatin accessibility are associated with the atherogenic transitioning of vascular smooth muscle cells. Cardiovascular research 2022-10-25 [PMID: 34849613]
• Quiroz-Figueroa K, Vitali C, Conlon DM Et al. TRIB1 regulates LDL metabolism through CEBP alpha-mediated effects on the LDL receptor in hepatocytes The Journal of clinical investigation 2021-11-15 [PMID: 34779419] (WB, Mouse)
• Chen Z, Zhang J, Wei D et al. GCN2 Regulates ATF3-p38 MAPK Signaling Transduction in Pulmonary Veno-Occlusive Disease Journal of cardiovascular pharmacology and therapeutics 2021-05-14 [PMID: 33988041]
• Zhu X, Xie W, Zhang J et al. Sympathectomy decreases pain behaviors and nerve regeneration by downregulating monocyte chemokine CCL2 in dorsal root ganglia in the rat tibial nerve crush model Pain 2022-01-01 [PMID: 33941753]
• Lindborg J, Tran N, Chenette D et al. Optic nerve regeneration screen identifies multiple genes restricting adult neural repair Cell Reports 2021-03-01 [PMID: 33657370] (IHC-Fr, Mouse)
• Xu Y, Li Y, Jadhav K, et al. Hepatocyte ATF3 protects against atherosclerosis by regulating HDL and bile acid metabolism Nature metabolism 2021-01-01 [PMID: 33462514]
• Ewan EE, Carlin D, Goncalves TM et al. Ascending dorsal column sensory neurons respond to spinal cord injury and downregulate genes related to lipid metabolism Sci Rep 2021-01-12 [PMID: 33431991]
• Kampanis V, Tolou-Dabbaghian B, Zhou L, et al. Cyclic Stretch of Either PNS or CNS Located Nerves Can Stimulate Neurite Outgrowth Cells 2020-12-28 [PMID: 33379276] (Rat)
• Hong L, Li F, Tang C et al. Semaphorin 7A promotes endothelial to mesenchymal transition through ATF3 mediated TGF- beta 2/Smad signaling Cell Death Dis 2020-01-01 [PMID: 32826874] (Chemotaxis, Human)
• Nguyen TTT, Zhang Y, Shang E et al. Inhibition of HDAC1/2 Along with TRAP1 Causes Synthetic Lethality in Glioblastoma Model Systems Cells 2020-07-10 [PMID: 32664214] (WB, Human)
• Vysokov N, McMahon SB, Raouf R The role of NaV channels in synaptic transmission after axotomy in a microfluidic culture platform Sci Rep [PMID: 31501450] (ICC/IF, Rat)
• Carlin D, Halevi AE, Ewan EE et al. Nociceptor Deletion of Tsc2 Enhances Axon Regeneration by Inducing a Conditioning Injury Response in Dorsal Root Ganglia eNeuro 2019-06-25 [PMID: 31182472]
• Holland, SD;Ramer, LM;McMahon, SB;Denk, F;Ramer, MS; An ATF3-CreERT2 Knock-In Mouse for Axotomy-Induced Genetic Editing: Proof of Principle eNeuro 2019-04-09 [PMID: 30993183] (IHC-Fr, ICC/IF, Mouse)
• Bianchetti E, Bates SJ, Carroll SL et al. Usp9X Regulates Cell Death in Malignant Peripheral Nerve Sheath Tumors. Sci Rep. 2018-11-26 [PMID: 30478285] (WB, Human)
• Mousseau M, Burma NE, Lee KY et al. Microglial pannexin-1 channel activation is a spinal determinant of joint pain Sci Adv 2018-08-01 [PMID: 30101191] (IHC-P, Rat)
• Edagawa M, Kawauchi J, Hirata M et al. Role of Activating Transcription Factor 3 (ATF3) in Endoplasmic Reticulum (ER) Stress-induced Sensitization of p53-deficient Human Colon Cancer Cells to Tumor Necrosis Factor (TNF)-related Apoptosis-inducing Ligand (TRAIL)-mediated Apoptosis through Up-regulation of Death Receptor 5 (DR5) by Zerumbone and Celecoxib. J Biol Chem 2014-08-01 [PMID: 24939851] (WB, Human)
• Wei S, Wang H, Lu C et al. The Activating Transcription Factor 3 Protein Suppresses the Oncogenic Function of Mutant p53 Proteins. J Biol Chem 2014-03-28 [PMID: 24554706] (IF/IHC, Human)
• Hai T, Jalgaonkar S, Wolford CC, Yin X. Immunohistochemical Detection of Activating Transcription Factor 3, a Hub of the Cellular Adaptive-Response Network. Methods Enzymol 2011-01-01 [PMID: 21266251]
• Wu X, Nguyen BC, Dziunycz P et al. Opposing roles for calcineurin and ATF3 in squamous skin cancer. Nature 2010-05-01 [PMID: 20485437]

Reviews for ATF3 Antibody (NBP1-85816) (3)

Average Rating: 4.3

(Based on 3 reviews)

We have 3 reviews tested in 3 species: Human, Rat, Feline.

reviewed by: Felix Oppel Indirect Immunofluorescence Human 05/03/2022

Summary

• Application: Other
• Sample Tested: Cell culture
• Species: Human
• Lot: 000016781

reviewed by: Verified Customer IHC-Fr Feline 10/19/2018

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Optic nerve
• Species: Feline
• Lot: B114876

reviewed by: Joanne Steinauer IHC-Fr Rat 09/15/2017

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Dorsal root ganglion
• Species: Rat
• Lot: B106628

Comments

• Comments: Fixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.

Bioinformatics

• Gene Symbol: ATF3