ATF3 Antibody

Images

 
Genetic Strategies: Knockout Validated: ATF3 Antibody [NBP1-85816] - HeLa human cervical epithelial carcinoma parental cell line lysate and ATF3 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.1 ...read more
Biological Strategies: Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. ...read more
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was ...read more
Genetic Strategies: Knockout Validated: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, FeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockout Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 24939851). ATF3 antibody validated for IHC-F from a verified customer review.
Control Peptide
ATF3 Protein (NBP1-85816PEP)
Reviewed Applications
Read 3 Reviews rated 4.3
using
NBP1-85816 in the following applications:

Publications
Read Publications using
NBP1-85816 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30993183). Reactivity reported in scientific literature (PMID: 21266251), Feline reactivity reported from a verified customer review. Rat reactivity reported in (PMID: 30101191), also customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF3 Antibody

  • activating transcription factor 3cAMP-dependent transcription factor ATF-3
  • ATF3deltaZip2
  • ATF3deltaZip2c
  • ATF3deltaZip3
  • cyclic AMP-dependent transcription factor ATF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

212-GD/CF
Species: Hu
Applications: Bind, BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DGD150
Species: Hu
Applications: ELISA
NBP1-85816
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO

Publications for ATF3 Antibody (NBP1-85816)(17)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 6 applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, WB.


Filter By Application
ChIP
(1)
ICC/IF
(3)
IHC
(1)
IHC-Fr
(3)
IHC-P
(1)
WB
(4)
All Applications
Filter By Species
Human
(5)
Mouse
(5)
Rat
(3)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using NBP1-85816 Applications Species
Quiroz-Figueroa K, Vitali C, Conlon DM Et al. TRIB1 regulates LDL metabolism through CEBP alpha-mediated effects on the LDL receptor in hepatocytes The Journal of clinical investigation Nov 15 2021 [PMID: 34779419] (WB, Mouse) WB Mouse
Chen Z, Zhang J, Wei D et al. GCN2 Regulates ATF3-p38 MAPK Signaling Transduction in Pulmonary Veno-Occlusive Disease Journal of cardiovascular pharmacology and therapeutics May 14 2021 [PMID: 33988041]
Lindborg J, Tran N, Chenette D et al. Optic nerve regeneration screen identifies multiple genes restricting adult neural repair Cell Reports Mar 1 2021 [PMID: 33657370] (IHC-Fr, Mouse) IHC-Fr Mouse
Xu Y, Li Y, Jadhav K, et al. Hepatocyte ATF3 protects against atherosclerosis by regulating HDL and bile acid metabolism Nature metabolism Jan 1 2021 [PMID: 33462514]
Kampanis V, Tolou-Dabbaghian B, Zhou L, et al. Cyclic Stretch of Either PNS or CNS Located Nerves Can Stimulate Neurite Outgrowth Cells Dec 28 2020 [PMID: 33379276] (Rat) Rat
Hong L, Li F, Tang C et al. Semaphorin 7A promotes endothelial to mesenchymal transition through ATF3 mediated TGF- beta 2/Smad signaling Cell Death Dis Jan 1 2020 [PMID: 32826874] (ChIP, Human) ChIP Human
Nguyen TTT, Zhang Y, Shang E et al. Inhibition of HDAC1/2 Along with TRAP1 Causes Synthetic Lethality in Glioblastoma Model Systems Cells Jul 10 2020 [PMID: 32664214] (WB, Human) WB Human
Hai T, Jalgaonkar S, Wolford CC, Yin X. Immunohistochemical Detection of Activating Transcription Factor 3, a Hub of the Cellular Adaptive-Response Network. Methods Enzymol 2011 [PMID: 21266251]
Ewan EE, Carlin D, Goncalves TM et al. Ascending dorsal column sensory neurons respond to spinal cord injury and downregulate genes related to lipid metabolism bioRxiv Jan 1 2020 (ICC/IF, Mouse) ICC/IF Mouse
Vysokov N, McMahon SB, Raouf R The role of NaV channels in synaptic transmission after axotomy in a microfluidic culture platform Sci Rep [PMID: 31501450] (ICC/IF, Rat) ICC/IF Rat
Show All 17 Publications.

Reviews for ATF3 Antibody (NBP1-85816) (3) 4.33

Average Rating: 4.3
(Based on 3 reviews)
We have 3 reviews tested in 3 species: Human, Rat, Feline.

Reviews using NBP1-85816:
Filter by Applications
Indirect Immunofluorescence
(1)
Immunohistochemistry-Frozen
(2)
All Applications
Filter by Species
Human
(1)
Rat
(1)
Feline
(1)
All Species
Images Ratings Applications Species Date Details
Other ATF3 NBP1-85816
Enlarge
4
reviewed by:
Verified Customer
Indirect Immunofluorescence Human 05/03/2022
View

Summary

ApplicationOther
Sample TestedCell culture
SpeciesHuman
Lot000016781
Immunohistochemistry-Frozen ATF3 NBP1-85816
Enlarge
4
reviewed by:
David Sun
Immunohistochemistry-Frozen Feline 10/19/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedOptic nerve
SpeciesFeline
LotB114876
Immunohistochemistry-Frozen ATF3 NBP1-85816
Enlarge
5
reviewed by:
Verified Customer
Immunohistochemistry-Frozen Rat 09/15/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedDorsal root ganglion
SpeciesRat
LotB106628

Comments

CommentsFixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATF3 Antibody (NBP1-85816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF3 Products

Bioinformatics Tool for ATF3 Antibody (NBP1-85816)

Discover related pathways, diseases and genes to ATF3 Antibody (NBP1-85816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF3 Antibody (NBP1-85816)

Discover more about diseases related to ATF3 Antibody (NBP1-85816).
 

Pathways for ATF3 Antibody (NBP1-85816)

View related products by pathway.

PTMs for ATF3 Antibody (NBP1-85816)

Learn more about PTMs related to ATF3 Antibody (NBP1-85816).
 

Research Areas for ATF3 Antibody (NBP1-85816)

Find related products by research area.

Blogs on ATF3.

Chemotherapy-induced metastasis: An unexpected foe?
By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che...  Read full blog post.

Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State
MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
2
3
0
2
0
1
0

Verified Customer
05/03/2022
Application: Indirect Immunofluorescence
Species: Human

David Sun
10/19/2018
Application: Immunohistochemistry-Frozen
Species: Feline

Verified Customer
09/15/2017
Application: Immunohistochemistry-Frozen
Species: Rat

Bioinformatics

Gene Symbol ATF3