Hepcidin Antimicrobial Peptide Antibody

Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.

• Reactivity: Hu, Mu, Bv
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Hepcidin Antimicrobial Peptide Antibody Summary

• Immunogen: Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAMP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100 - 1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: This is a rabbit polyclonal antibody against HAMP and was validated on Western blot. Immunohistochemistry Paraffin (IHC-P) reported in verified customer review.
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26305890). Use in Bovine reported in scientific literature (PMID:31811823).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional when storing this antibody at -20C and not aliquoting smaller units. Please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hepcidin Antimicrobial Peptide Antibody

• HAMP
• HEPC
• hepcidin antimicrobial peptide
• Hepcidin
• HEPCPutative liver tumor regressor
• HFE2B
• HFE2Bhepcidin
• LEAP1
• LEAP-1
• LEAP1PLTR
• Liver-expressed antimicrobial peptide 1
• PLTR

Background

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)(2)

Publications using NBP1-59337

• Ashok A, Chaudhary S, McDonald D, et al. Local synthesis of hepcidin in the anterior segment of the eye: A novel observation with physiological and pathological implications. Exp Eye Res 2019 Dec 4 [PMID: 31811823] (WB, Bovine)
• Bose C, Megyesi JK, Shah SV et al. Evidence Suggesting a Role of Iron in a Mouse Model of Nephrogenic Systemic Fibrosis. PLoS One 2015 [PMID: 26305890] (WB, Mouse)

Reviews for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337) (6)

Average Rating: 4.5

(Based on 6 reviews)

We have 6 reviews tested in 3 species: Human, Mouse, Bovine.

reviewed by: Anonymous IHC-P Mouse 04/10/2019

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: mouse eye
• Species: Mouse
• Lot: QC12391-42894

Comments

• Comments: Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.

reviewed by: Anonymous WB Mouse 08/08/2018

Summary

• Application: Western Blot
• Sample Tested: Adult pancreas
• Species: Mouse
• Lot: QC12391-42894

reviewed by: Anonymous IHC-P Bovine 08/03/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: eye
• Species: Bovine
• Lot: QC12391-42894

reviewed by: Anonymous IHC-P Human 07/13/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: human eye
• Species: Human
• Lot: QC12391-42894

reviewed by: Anonymous WB Human 07/11/2018

Summary

• Application: Western Blot
• Sample Tested: Hepcidin peptide
• Species: Human
• Lot: QC12391-42894

reviewed by: Anonymous WB Bovine 06/29/2018

Summary

• Application: Western Blot
• Sample Tested: Adult eye and muscle tissue (labeled E and M
• Species: Bovine
• Lot: QC12391-42894

Comments

• Comments: 1:500

Bioinformatics

• Gene Symbol: HAMP
• Uniprot:
  • P81172()