Reactivity | Hu, Mu, BvSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | HAMP |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against HAMP and was validated on Western blot. Immunohistochemistry Paraffin (IHC-P) reported in verified customer review. |
|
Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
IHC-P | Mouse | 04/10/2019 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 08/08/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
IHC-P | Bovine | 08/03/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
IHC-P | Human | 07/13/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Human | 07/11/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Bovine | 06/29/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)Discover more about diseases related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
| Pathways for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)View related products by pathway.
|
PTMs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)Learn more about PTMs related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Anonymous 04/10/2019 |
||
Application: | IHC-P | |
Species: | Mouse |
Anonymous 08/08/2018 |
||
Application: | WB | |
Species: | Mouse |
Anonymous 08/03/2018 |
||
Application: | IHC-P | |
Species: | Bovine |