Hepcidin Antimicrobial Peptide Antibody

Images

 
Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hepcidin Antimicrobial Peptide Antibody Summary

Immunogen
Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:2000
Application Notes
This is a rabbit polyclonal antibody against HAMP and was validated on Western blot.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 5 Reviews rated 4.6
using
NBP1-59337 in the following application:

Publications
Read Publication using
NBP1-59337 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional when storing this antibody at -20C and not aliquoting smaller units. Please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hepcidin Antimicrobial Peptide Antibody

  • HAMP
  • HEPC
  • hepcidin antimicrobial peptide
  • Hepcidin
  • HEPCPutative liver tumor regressor
  • HFE2B
  • HFE2Bhepcidin
  • LEAP1
  • LEAP-1
  • LEAP1PLTR
  • Liver-expressed antimicrobial peptide 1
  • PLTR

Background

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3720
Species: Hu, Mu
Applications: WB, ICC
7270-IL/CF
Species: Hu
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3120
Species: Hu
Applications: WB, Simple Western
NBP1-21502
Species: Hu, Mu, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF7509
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
8146-GD/CF
Species: Hu
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
NBP1-59337
Species: Hu, Bv
Applications: WB

Publications for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337) (5) 4.65

Average Rating: 4.6
(Based on 5 reviews)
We have 5 reviews tested in 3 species: Human, Mouse, Bovine.

Reviews using NBP1-59337:
Filter by Applications
WB
(3)
IHC-P
(2)
All Applications
Filter by Species
Human
(2)
Mouse
(1)
Bovine
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Hepcidin Antimicrobial Peptide NBP1-59337
Enlarge
reviewed by:
Anonymous
WB Mouse 08/08/2018
View

Summary

ApplicationWestern Blot
Sample TestedAdult pancreas
SpeciesMouse
LotQC12391-42894
Immunohistochemistry-Paraffin Hepcidin Antimicrobial Peptide NBP1-59337
Enlarge
reviewed by:
Anonymous
IHC-P Bovine 08/03/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedeye
SpeciesBovine
LotQC12391-42894
Immunohistochemistry-Paraffin Hepcidin Antimicrobial Peptide NBP1-59337
Enlarge
reviewed by:
Anonymous
IHC-P Human 07/13/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedhuman eye
SpeciesHuman
LotQC12391-42894
Western Blot Hepcidin Antimicrobial Peptide NBP1-59337
Enlarge
reviewed by:
Anonymous
WB Human 07/11/2018
View

Summary

ApplicationWestern Blot
Sample TestedHepcidin peptide
SpeciesHuman
LotQC12391-42894
Western Blot Hepcidin Antimicrobial Peptide NBP1-59337
Enlarge
reviewed by:
Anonymous
WB Bovine 06/29/2018
View

Summary

ApplicationWestern Blot
Sample TestedAdult eye and muscle tissue (labeled E and M
SpeciesBovine
LotQC12391-42894

Comments

Comments1:500

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Discover related pathways, diseases and genes to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Discover more about diseases related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
 

Pathways for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

View related products by pathway.

PTMs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Learn more about PTMs related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).

Blogs on Hepcidin Antimicrobial Peptide

There are no specific blogs for Hepcidin Antimicrobial Peptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.6
5
4
4
0
3
1
2
0
1
0

Anonymous
08/08/2018
Application: WB
Species: Mouse

Anonymous
08/03/2018
Application: IHC-P
Species: Bovine

Anonymous
07/13/2018
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol HAMP
Uniprot