Home » Hepcidin Antimicrobial Peptide » Hepcidin Antimicrobial Peptide Antibodies » Hepcidin Antimicrobial Peptide Antibody

Hepcidin Antimicrobial Peptide Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.
Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Hepcidin Antimicrobial Peptide Antibody Summary

Immunogen
Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAMP and was validated on Western blot.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-59337 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hepcidin Antimicrobial Peptide Antibody

  • HAMP
  • HEPC
  • hepcidin antimicrobial peptide
  • Hepcidin
  • HEPCPutative liver tumor regressor
  • HFE2B
  • HFE2Bhepcidin
  • LEAP1
  • LEAP-1
  • LEAP1PLTR
  • Liver-expressed antimicrobial peptide 1
  • PLTR

Background

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RGM-C/Hemojuvelin
Antibody
AF3634
RGM-C/Hemojuvelin Antibody
(4 Publications)
Species: Mu
Applications: WB
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF
Transferrin
Antibody (HTF-14)
NB500-418
Western Blot: Transferrin Antibody (HTF-14) [NB500-418] - Analysis using the Azide Free version of NB500-418. Detection of 1. hTransferrin; 5 ug/well (red. con.) 2. hTransferrin; 3 ug/well (red. con.) 3. hTransferrin; 1 ug/well (red. con.) M. Low Range marker 4. hTransferrin; 1 ug/well (non-red. con.) 5. hTransferrin; 3 ug/well (non-red. con.) 6. hTransferrin; 5 ug/well (non-red. con.)
(1 Review)
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
TfR2 Antibody
(353816) [Unconjugate
MAB3120
Western blot shows lysates of human liver tissue and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for TfR2 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human liver tissue, loaded at 0.2 mg/mL. A specific band was detected for TfR2 at approximately 104 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Species: Hu
Applications: WB, Simple Western

Ferroportin/SLC40A1 An
NBP1-21502
Western Blot: Ferroportin/SLC40A1 Antibody [NBP1-21502] - Bovine adult eye. Image was submitted via customer review.
Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP1-21502] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Ferroportin/SLC40A1 conjugated to Alexa Fluor 488 [NBp1-21502AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP1-21502] - IHC-P detection of FPN1 / SLC40A1 protein in murine small intestinal section using Ferroportin 1 antibody at a dilution of 1:200. The antibody primarily developed a membranous staining pattern in the intestinal epithelial cells.
(5 Reviews)
(34 Publications)
Species: Hu, Mu, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Matriptase 2
Knockout HeLa Cell Ly
NBP2-66145
Matriptase 2 Knockout HeLa Cell Lysate
Species: Hu
BMP-6
[Unconjugated]
507-BP
1 μg/lane of Recombinant Human BMP-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 18 kDa and 32 kDa, respectively.
Recombinant Human BMP-6 (Catalog #507-BP) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 0.02‑0.15 μg/mL.
(1 Review)
(43 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(506 Publications)
Species: Hu

NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
(7 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P
CHMP2B Antibody
(791521)
MAB7509
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human CHMP2B Monoclonal Antibody (Catalog # MAB7509) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for CHMP2B at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CHMP2B was detected in immersion fixed paraffin-embedded sections of human brain (medulla) using Mouse Anti-Human CHMP2B Monoclonal Antibody (Catalog # MAB7509) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Staining is shown at both high (upper panel) and low (lower panel) magnification, and specific staining was localized to neuronal cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
DMRT1 Antibody
NBP1-84071
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows low expression as expected.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Ceruloplasmin
Native Protein
NBP2-12553
HPLC: Ceruloplasmin Native Protein [NBP2-12553]
Species: Hu
EPX Antibody
NBP2-13967
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human duodenum shows moderate cytoplasmic positivity in some peripheral leukocytes.
Species: Hu
Applications: IHC, IHC-P
Hepcidin
Antimicrobial Peptide
NBP1-59337
Hepcidin Antimicrobial Peptide Antibody
Species: Hu
Applications: WB

Publications for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337) (0)

There are no reviews for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Discover related pathways, diseases and genes to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Discover more about diseases related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
 

Pathways for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

View related products by pathway.

PTMs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)

Learn more about PTMs related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).

Blogs on Hepcidin Antimicrobial Peptide

There are no specific blogs for Hepcidin Antimicrobial Peptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hepcidin Antimicrobial Peptide Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HAMP
Entrez
Uniprot