![Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/Hepcidin Antimicrobial Peptide Antibody-Western Blot-NBP1-59337-img0002.jpg "Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.")
| Reactivity | Hu, BvSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HAMP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against HAMP and was validated on Western blot. |
|
| Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
| Publication using NBP1-59337 | Applications | Species |
|---|---|---|
| Bose C, Megyesi JK, Shah SV et al. Evidence Suggesting a Role of Iron in a Mouse Model of Nephrogenic Systemic Fibrosis. PLoS One 2015 [PMID: 26305890] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
IHC-P | Bovine | 08/03/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
IHC-P | Human | 07/13/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Human | 07/11/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Bovine | 06/29/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)Discover more about diseases related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
| Pathways for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)View related products by pathway.
|
PTMs for Hepcidin Antimicrobial Peptide Antibody (NBP1-59337)Learn more about PTMs related to Hepcidin Antimicrobial Peptide Antibody (NBP1-59337).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Anonymous 08/03/2018 |
||
| Application: | IHC-P | |
| Species: | Bovine |
| Anonymous 07/13/2018 |
||
| Application: | IHC-P | |
| Species: | Human |
| Anonymous 07/11/2018 |
||
| Application: | WB | |
| Species: | Human |
![Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.](http://images.novusbio.com/fullsize2/HFE-Antibody-(1G12)-Western-Blot-H00003077-M01-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/HFE-Antibody-(1G12)-Immunocytochemistry-Immunofluorescence-H00003077-M01-img0006.jpg)
![Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/HFE Antibody (1G12)-Western Blot-H00003077-M01-img0009.jpg)
![Western Blot: Ferroportin/SLC40A1 Antibody [NBP1-21502] - Duodenal mucosa samples from weanling pigs with iron replete or iron deficient status were probed for FPN1 (NBP1-21502; 1:1000 dilution) and GAPDH (loading control). Image from verified customer review.](http://images.novusbio.com/fullsize2/Ferroportin-SLC40A1-Antibody-Western-Blot-NBP1-21502-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP1-21502] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Ferroportin/SLC40A1 conjugated to Alexa Fluor 488 [NBp1-21502AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/Ferroportin-SLC40A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-21502-img0013.jpg)
![Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP1-21502] - IHC-P detection of FPN1 / SLC40A1 protein in murine small intestinal section using Ferroportin 1 antibody at a dilution of 1:200. The antibody primarily developed a membranous staining pattern in the intestinal epithelial cells.](http://images.novusbio.com/fullsize2/Ferroportin-SLC40A1-Antibody-Immunohistochemistry-Paraffin-NBP1-21502-img0008.jpg)
![Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/NRAMP2-SLC11A2-DMT1-Antibody-(4C6)-Immunohistochemistry-Paraffin-H00004891-M01-img0006.jpg)
![ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/NRAMP2-SLC11A2-DMT1-Antibody-(4C6)-ELISA-H00004891-M01-img0008.jpg)
![Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/DMRT1-Antibody-Western-Blot-NBP1-84071-img0007.jpg)
![Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/DMRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-84071-img0010.jpg)
![Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows low expression as expected.](http://images.novusbio.com/fullsize2/DMRT1-Antibody-Immunohistochemistry-Paraffin-NBP1-84071-img0008.jpg)
![HPLC: Ceruloplasmin Native Protein [NBP2-12553]](http://images.novusbio.com/fullsize2/Ceruloplasmin Native Protein-HPLC-NBP2-12553-img0001.jpg)
![Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize2/EPX-Antibody-Immunohistochemistry-Paraffin-NBP2-13967-img0004.jpg)
![Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize2/EPX-Antibody-Immunohistochemistry-Paraffin-NBP2-13967-img0002.jpg)
![Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human duodenum shows moderate cytoplasmic positivity in some peripheral leukocytes.](http://images.novusbio.com/fullsize2/EPX-Antibody-Immunohistochemistry-Paraffin-NBP2-13967-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")
