| Reactivity | HuSpecies Glossary |
| Applications | ELISA, IHC |
| Clone | 3G6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Specificity | GDF11 - growth differentiation factor 11 |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GDF11 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections. Antigen retrieval using 1X citrate buffer (pH 6.0) in pressure cooker under 125? for 4min and under 90? for 45min is recommended. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00010220-M01 | Applications | Species |
|---|---|---|
| Jackson WM, Aragon AB, Onodera J et al. Cytokine expression in muscle following traumatic injury. J Orthop Res 2011-10-01 [PMID: 21452302] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for GDF-11/BMP-11 Antibody (H00010220-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.