GCM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GCM1 Antibody [NBP3-17006] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: GCM1 Antibody [NBP3-17006] - Analysis in human placenta and pancreas tissues using Anti-GCM1 antibody. Corresponding GCM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GCM1 Antibody [NBP3-17006] - Staining of human placenta shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCM1 Antibody - BSA Free (NBP3-17006) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GCM1 Antibody - BSA Free

• GCM motif protein 1
• GCMA
• glial cells missing (Drosophila) homolog a
• glial cells missing homolog 1 (Drosophila)
• Glial cells missing homolog 1
• hGCMachorion-specific transcription factor GCMa

Background

GCM1 encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCM1