SLC1A5 Antibody


Immunocytochemistry/ Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues. Corresponding SLC1A5 RNA-seq data are presented for the same tissues.
Immunohistochemistry: SLC1A5 Antibody [NBP1-89327] - The expression of SLC1A5 in human hepatocellular carcinoma. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SLC1A5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
Specificity of human SLC1A5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC1A5 Protein (NBP1-89327PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-89327 in the following applications:

Read Publication using
NBP1-89327 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC1A5 Antibody

  • AAAT
  • ASCT2M7VS1
  • ATB(0)
  • Baboon M7 virus receptor
  • M7V1ATBO
  • neutral amino acid transporter B
  • neutral amino acid transporter B(0)
  • R16
  • RD114 virus receptor
  • RD114/simian type D retrovirus receptor
  • RDR
  • RDRCFLJ31068
  • Sodium-dependent neutral amino acid transporter type 2
  • solute carrier family 1 (neutral amino acid transporter), member 5
  • Solute carrier family 1 member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC-Fr, IHC-P, In vitro, B/N

Publications for SLC1A5 Antibody (NBP1-89327)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Review for SLC1A5 Antibody (NBP1-89327) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89327:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry SLC1A5 NBP1-89327
reviewed by:
IHC Human 07/11/2017


Sample TestedHepatocellular Carcinoma

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC1A5 Antibody (NBP1-89327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC1A5 Antibody (NBP1-89327)

Discover related pathways, diseases and genes to SLC1A5 Antibody (NBP1-89327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC1A5 Antibody (NBP1-89327)

Discover more about diseases related to SLC1A5 Antibody (NBP1-89327).

Pathways for SLC1A5 Antibody (NBP1-89327)

View related products by pathway.

PTMs for SLC1A5 Antibody (NBP1-89327)

Learn more about PTMs related to SLC1A5 Antibody (NBP1-89327).

Blogs on SLC1A5

There are no specific blogs for SLC1A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC
Species: Human


Gene Symbol SLC1A5