SLC1A5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC1A5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC1A5 Protein (NBP1-89327PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89327 in the following applications:

Publications
Read Publication using
NBP1-89327 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC1A5 Antibody

  • AAAT
  • ASCT2M7VS1
  • ATB(0)
  • Baboon M7 virus receptor
  • M7V1ATBO
  • neutral amino acid transporter B
  • neutral amino acid transporter B(0)
  • R16
  • RD114 virus receptor
  • RD114/simian type D retrovirus receptor
  • RDR
  • RDRCFLJ31068
  • Sodium-dependent neutral amino acid transporter type 2
  • solute carrier family 1 (neutral amino acid transporter), member 5
  • Solute carrier family 1 member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60038
Species: Hu
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-93579
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro

Publications for SLC1A5 Antibody (NBP1-89327)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for SLC1A5 Antibody (NBP1-89327) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC.

Reviews using NBP1-89327:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry SLC1A5 NBP1-89327
Enlarge
reviewed by:
Anonymous
IHC Human 07/11/2017
View

Summary

ApplicationImmunohistochemistry
Sample TestedHepatocellular Carcinoma
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC1A5 Antibody (NBP1-89327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC1A5 Products

Bioinformatics Tool for SLC1A5 Antibody (NBP1-89327)

Discover related pathways, diseases and genes to SLC1A5 Antibody (NBP1-89327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC1A5 Antibody (NBP1-89327)

Discover more about diseases related to SLC1A5 Antibody (NBP1-89327).
 

Pathways for SLC1A5 Antibody (NBP1-89327)

View related products by pathway.

PTMs for SLC1A5 Antibody (NBP1-89327)

Learn more about PTMs related to SLC1A5 Antibody (NBP1-89327).

Blogs on SLC1A5

There are no specific blogs for SLC1A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
07/11/2017
Application: IHC
Species: Human

Bioinformatics

Gene Symbol SLC1A5
Entrez
Uniprot