SLC1A5 Antibody

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues . Corresponding SLC1A5 RNA-seq data are presented for the same tissues.

Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in human cell line NB4.

Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human hepatocellular carcinoma. Image from a verified customer review.

Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

• Reactivity: Hu, Mu, Po
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC1A5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC1A5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. SLC1A5 antibody validated for IHC-P from a verified customer review.
• Control Peptide:

  SLC1A5 Protein (NBP1-89327PEP)

Reactivity Notes

Use in Porcine reported in scientific literature (PMID:34488623). Mouse reactivity reported in scientific literature (PMID: 31387898).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC1A5 Antibody

• AAAT
• ASCT2M7VS1
• ATB(0)
• Baboon M7 virus receptor
• M7V1ATBO
• neutral amino acid transporter B
• neutral amino acid transporter B(0)
• R16
• RD114 virus receptor
• RD114/simian type D retrovirus receptor
• RDR
• RDRCFLJ31068
• Sodium-dependent neutral amino acid transporter type 2
• solute carrier family 1 (neutral amino acid transporter), member 5
• Solute carrier family 1 member 5

Background

SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC1A5 Antibody (NBP1-89327)(4)

Publications using NBP1-89327

• Romanet S, Aschenbach JR, Pieper R et al. Expression of proposed methionine transporters along the gastrointestinal tract of pigs and their regulation by dietary methionine sources Genes & nutrition 2021-09-06 [PMID: 34488623] (WB, Porcine)
• Wu WC, Sun HW, Chen J et al. Immunosuppressive immature myeloid cell generation is controlled by glutamine metabolism in human cancer Cancer Immunol Res 2019-08-06 [PMID: 31387898] (ICC/IF, IHC-P, Mouse)
• Sun HW, Yu XJ, Wu WC et al. GLUT1 and ASCT2 as Predictors for Prognosis of Hepatocellular Carcinoma. PLoS ONE. 2016-12-30 [PMID: 28036362] (IHC, Human)
• Liu Y, Liu T, Zhou Y et al. Impeding the combination of astrocytic ASCT2 and NLRP3 by talniflumate alleviates neuroinflammation in experimental models of Parkinson’s disease Acta Pharmaceutica Sinica B 2022-08-01 (ICC/IF, PLA, WB)

Review for SLC1A5 Antibody (NBP1-89327) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Hong Wei Sun IHC Human 07/11/2017

Summary

• Application: Immunohistochemistry
• Sample Tested: Hepatocellular Carcinoma
• Species: Human

Bioinformatics

• Gene Symbol: SLC1A5
• Entrez:
  • 6510(Human)
• Uniprot:
  • Q15758(Human)