OASIS/CREB3L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: OASIS/CREB3L1 Antibody [NBP1-82503] - Staining in human pancreas and lymph node tissues using anti-CREB3L1 antibody. Corresponding CREB3L1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OASIS/CREB3L1 Antibody [NBP1-82503] - Staining of human pancreas shows high expression.

Immunohistochemistry-Paraffin: OASIS/CREB3L1 Antibody [NBP1-82503] - Staining of human lymph node shows low expression as expected.

ChIP-Exo-Seq composite graph for Anti-CREB3L1 (NBP1-82503) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OASIS/CREB3L1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREB3L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC reported in scientific literature (PMID: 28186972). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OASIS/CREB3L1 Recombinant Protein Antigen (NBP1-82503PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OASIS/CREB3L1 Antibody - BSA Free

• BBF-2 Homolog
• cAMP responsive element binding protein 3-like 1
• cAMP-responsive element-binding protein 3-like protein 1
• CREB3L1
• OASIS
• OASIScyclic AMP-responsive element-binding protein 3-like protein 1
• old astrocyte specifically induced substance
• Old astrocyte specifically-induced substance

Background

Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein responsetarget genes. Specifically involved in ER-stress response in astrocytes in the central nervous system (Bysimilartity). May play a role in gliosis. In vitro, binds to box-B element, cAMP response element (CRE) and CRE-likesequences, and activates transcription through box-B element but not through CRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OASIS/CREB3L1 Antibody (NBP1-82503)(1)

Publication using NBP1-82503

• Brunetti M, Agostini A, Davidson B et al. Recurrent fusion transcripts in squamous cell carcinomas of the vulva. Oncotarget. 2017-02-07 [PMID: 28186972] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CREB3L1