GATA-6 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GATA-6 (NP_005248). Peptide sequence SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GATA6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GATA-6 Antibody - BSA Free
Background
The Gata6 gene is a transcriptional activator that is crucial to modulating terminal differentiation and/or proliferation by regulating SEMA3C and PLXNA2. The Gata6 gene is most prominent during vertebrate development in early and later embryogenesis. Two isoforms exist: isoform 1 is 595 amino acids long at 60 kDa and isoform 2 exists at 449 amino acids in length and 45 kDA. The Gata6 gene focuses on endo- and mesodermally derived cells, thus participating significantly in gut, lung, and heart development and mutations of the Gata6 gene are linked to multiple congenital defects. The Gata6 gene has also been associated with polycystic ovary syndrome, hernias, teratoma, pulmonary fibrosis, germ cell tumor, gastric cancer, Crohn's disease, colorectal cancer, colon cancer, and carcinoma. It is known to interact with KLF13, MED1, HHEX, KLF2, and SP1 as it functions in pathways such as lymphocyte signaling, heart development, hemostasis, and thrombin signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for GATA-6 Antibody (NBP3-10916) (0)
There are no publications for GATA-6 Antibody (NBP3-10916).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GATA-6 Antibody (NBP3-10916) (0)
There are no reviews for GATA-6 Antibody (NBP3-10916).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GATA-6 Antibody (NBP3-10916) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GATA-6 Products
Research Areas for GATA-6 Antibody (NBP3-10916)
Find related products by research area.
|
Blogs on GATA-6