GATA-5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GATA-5 Antibody [NBP2-56593] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GATA-5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
Specificity
Specificity of human GATA-5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATA5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GATA-5 Recombinant Protein Antigen (NBP2-56593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GATA-5 Antibody

  • bB379O24.1
  • GATA binding factor-5
  • GATA binding protein 5
  • GATA5
  • GATA-5
  • GATA-binding factor 5
  • GATA-binding protein 5
  • transcription factor GATA-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24585
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24585
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2170
Species: Hu
Applications: WB, ChIP, ICC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-24583
Species: Hu, Mu, Rt, Bv, Eq, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
AF3876
Species: Hu, Mu
Applications: WB, IHC
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for GATA-5 Antibody (NBP2-56593) (0)

There are no publications for GATA-5 Antibody (NBP2-56593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-5 Antibody (NBP2-56593) (0)

There are no reviews for GATA-5 Antibody (NBP2-56593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GATA-5 Antibody (NBP2-56593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GATA-5 Products

Bioinformatics Tool for GATA-5 Antibody (NBP2-56593)

Discover related pathways, diseases and genes to GATA-5 Antibody (NBP2-56593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-5 Antibody (NBP2-56593)

Discover more about diseases related to GATA-5 Antibody (NBP2-56593).
 

Pathways for GATA-5 Antibody (NBP2-56593)

View related products by pathway.

PTMs for GATA-5 Antibody (NBP2-56593)

Learn more about PTMs related to GATA-5 Antibody (NBP2-56593).

Blogs on GATA-5

There are no specific blogs for GATA-5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATA-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA5