GATA-5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GATA-5 Antibody [NBP2-56593] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GATA-5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GATA-5 Antibody - BSA Free (NBP2-56593) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GATA-5 Recombinant Protein Antigen (NBP2-56593PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GATA-5 Antibody - BSA Free

• bB379O24.1
• GATA binding factor-5
• GATA binding protein 5
• GATA5
• GATA-5
• GATA-binding factor 5
• GATA-binding protein 5
• transcription factor GATA-5

Background

GATA5 is encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATA5