GART Antibody

Images

 
Immunohistochemistry-Paraffin: GART Antibody [NBP1-87291] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GART Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GART
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GART Protein (NBP1-87291PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GART Antibody

  • AIRS
  • EC 6.3.3.1
  • EC 6.3.4.13
  • GARS
  • GARTF
  • MGC47764
  • PGFTEC 2.1.2.210PAIS
  • phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamidesynthetase, phosphoribosylaminoimidazole synthetase
  • trifunctional purine biosynthetic protein adenosine-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GART Antibody (NBP1-87291) (0)

There are no publications for GART Antibody (NBP1-87291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GART Antibody (NBP1-87291) (0)

There are no reviews for GART Antibody (NBP1-87291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GART Antibody (NBP1-87291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GART Products

Bioinformatics Tool for GART Antibody (NBP1-87291)

Discover related pathways, diseases and genes to GART Antibody (NBP1-87291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GART Antibody (NBP1-87291)

Discover more about diseases related to GART Antibody (NBP1-87291).
 

Pathways for GART Antibody (NBP1-87291)

View related products by pathway.

PTMs for GART Antibody (NBP1-87291)

Learn more about PTMs related to GART Antibody (NBP1-87291).
 

Research Areas for GART Antibody (NBP1-87291)

Find related products by research area.

Blogs on GART

There are no specific blogs for GART, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GART Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GART
Entrez
Uniprot