Novus Biologicals products are now on bio-techne.com

GDAP1 Antibody

Images

 
Western Blot: GDAP1 Antibody [NBP1-84430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: GDAP1 Antibody [NBP1-84430] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & mitochondria. Antibody staining shown in green.
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human liver.
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining in human cerebral cortex and pancreas tissues using anti-GDAP1 antibody. Corresponding GDAP1 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human cerebellum, liver, pancreas and testis using Anti-GDAP1 antibody NBP1-84430 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human testis.
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human cerebellum.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY
Predicted Species
Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GDAP1 Protein (NBP1-84430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDAP1 Antibody

  • Charcot-Marie-Tooth neuropathy 4A
  • CMT2K
  • CMT4
  • CMT4A
  • CMTRIA
  • ganglioside differentiation associated protein 1
  • ganglioside-induced differentiation-associated protein 1
  • truncated ganglioside differentiation associated protein 1

Background

The GDAP1 gene encodes for a member of the ganglioside-induced differentiation-associated protein family that is active in signal transduction pathways during neuronal development. These proteins also monitor the mitochondrial network by endorsing mitochondrial fission. Isoform 1 is 358 amino acids long at 41 kDA while isoform 2 is 290 amino acids long at approximately 33 kDA. Neuropathy, muscular dystrophy, and multiple forms of Charcot-Marie-Tooth Disease have been linked to mutations in the GDAP1 gene. The GDAP1 gene is involved in NgR-p75(NTR)-Mediated signaling and interacts with genes such as FIS1, ATP6V1D, TUBB, UBC, and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NBP2-13283
Species: Hu
Applications: IHC, IHC-P, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
NBP3-21685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-131
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-89598
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GDAP1 Antibody (NBP1-84430) (0)

There are no publications for GDAP1 Antibody (NBP1-84430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDAP1 Antibody (NBP1-84430) (0)

There are no reviews for GDAP1 Antibody (NBP1-84430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GDAP1 Antibody (NBP1-84430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDAP1 Products

Array NBP1-84430

Research Areas for GDAP1 Antibody (NBP1-84430)

Find related products by research area.

Blogs on GDAP1

There are no specific blogs for GDAP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDAP1