GDAP1 Antibody

Images

 
Western Blot: GDAP1 Antibody [NBP1-84430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: GDAP1 Antibody [NBP1-84430] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: GDAP1 Antibody [NBP1-84430] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GDAP1 Protein (NBP1-84430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDAP1 Antibody

  • Charcot-Marie-Tooth neuropathy 4A
  • CMT2K
  • CMT4
  • CMT4A
  • CMTRIA
  • ganglioside differentiation associated protein 1
  • ganglioside-induced differentiation-associated protein 1
  • truncated ganglioside differentiation associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBL1-15012
Species: Hu
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89598
Species: Hu, Mu, Ca
Applications: IHC, IHC-Fr, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-38360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GDAP1 Antibody (NBP1-84430) (0)

There are no publications for GDAP1 Antibody (NBP1-84430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDAP1 Antibody (NBP1-84430) (0)

There are no reviews for GDAP1 Antibody (NBP1-84430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GDAP1 Antibody (NBP1-84430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDAP1 Products

Bioinformatics Tool for GDAP1 Antibody (NBP1-84430)

Discover related pathways, diseases and genes to GDAP1 Antibody (NBP1-84430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDAP1 Antibody (NBP1-84430)

Discover more about diseases related to GDAP1 Antibody (NBP1-84430).
 

Pathways for GDAP1 Antibody (NBP1-84430)

View related products by pathway.

PTMs for GDAP1 Antibody (NBP1-84430)

Learn more about PTMs related to GDAP1 Antibody (NBP1-84430).

Blogs on GDAP1

There are no specific blogs for GDAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDAP1