gamma C Crystallin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit gamma C Crystallin Antibody - BSA Free (NBP3-03301) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human gamma C Crystallin (NP_066269.1). MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CRYGC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:1000-1:2000
|
| Theoretical MW |
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for gamma C Crystallin Antibody - BSA Free
Background
Gamma-crystallin C, or CRYGC for short, contains a 174 amino acid isoform that is 21 kDa, and is involved in supporting the eye lens through its highly symmetrical and organized gene cluster. Research has found that defects in the protein are a cause of autosomal dominant cataracts, and current research is being conducted to determine the protein's relation to a variety of other diseases and disorders, including variable zonular pulverulent cataract, coppock-like cataract, blindness, pneumonia, ADHD, bronchitis, and cancer. Gamma-crystallin C has been linked to eye development and visual perception, and interacts with proteins such as CRYAA, CRYBB2, CRYAB, and HSPB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Publications for gamma C Crystallin Antibody (NBP3-03301) (0)
There are no publications for gamma C Crystallin Antibody (NBP3-03301).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for gamma C Crystallin Antibody (NBP3-03301) (0)
There are no reviews for gamma C Crystallin Antibody (NBP3-03301).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for gamma C Crystallin Antibody (NBP3-03301) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional gamma C Crystallin Products
Research Areas for gamma C Crystallin Antibody (NBP3-03301)
Find related products by research area.
|
Blogs on gamma C Crystallin