GALK1 Antibody

Images

 
Independent Antibodies: Western Blot: GALK1 Antibody [NBP1-81853] - Analysis using Anti-GALK1 antibody NBP1-81853 (A) shows similar pattern to independent antibody NBP1-81854 (B).
Immunocytochemistry/ Immunofluorescence: GALK1 Antibody [NBP1-81853] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: GALK1 Antibody [NBP1-81853] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: GALK1 Antibody [NBP1-81853] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

GALK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFI
Specificity
Specificity of human GALK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
GALK1 Knockout HeLa Cell Lysate
Control Peptide
GALK1 Protein (NBP1-81853PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALK1 Antibody

  • EC 2.7.1.6
  • galactokinase 1
  • galactokinase
  • Galactose kinase
  • GALK
  • GK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03390
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-70822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1197
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33401
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GALK1 Antibody (NBP1-81853) (0)

There are no publications for GALK1 Antibody (NBP1-81853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALK1 Antibody (NBP1-81853) (0)

There are no reviews for GALK1 Antibody (NBP1-81853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GALK1 Antibody (NBP1-81853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GALK1 Products

Bioinformatics Tool for GALK1 Antibody (NBP1-81853)

Discover related pathways, diseases and genes to GALK1 Antibody (NBP1-81853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALK1 Antibody (NBP1-81853)

Discover more about diseases related to GALK1 Antibody (NBP1-81853).
 

Pathways for GALK1 Antibody (NBP1-81853)

View related products by pathway.

Blogs on GALK1

There are no specific blogs for GALK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALK1