Rpn2 Antibody

Images

 
Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human liver.
Immunohistochemistry: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Independent Antibodies: Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human kidney.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Rpn2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
Specificity
Specificity of human Rpn2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rpn2 Protein (NBP2-38323PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rpn2 Antibody

  • 26S proteasome non-ATPase regulatory subunit 1
  • 26S proteasome regulatory subunit RPN2
  • 26S proteasome regulatory subunit S1
  • 26S proteasome subunit p112
  • MGC133040
  • MGC133041
  • P112
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
  • Rpn2
  • S1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-38323
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rpn2 Antibody (NBP2-38323) (0)

There are no publications for Rpn2 Antibody (NBP2-38323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rpn2 Antibody (NBP2-38323) (0)

There are no reviews for Rpn2 Antibody (NBP2-38323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rpn2 Antibody (NBP2-38323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rpn2 Products

Bioinformatics Tool for Rpn2 Antibody (NBP2-38323)

Discover related pathways, diseases and genes to Rpn2 Antibody (NBP2-38323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rpn2 Antibody (NBP2-38323)

Discover more about diseases related to Rpn2 Antibody (NBP2-38323).
 

Pathways for Rpn2 Antibody (NBP2-38323)

View related products by pathway.

PTMs for Rpn2 Antibody (NBP2-38323)

Learn more about PTMs related to Rpn2 Antibody (NBP2-38323).
 

Research Areas for Rpn2 Antibody (NBP2-38323)

Find related products by research area.

Blogs on Rpn2

There are no specific blogs for Rpn2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rpn2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD1
Uniprot