Rpn2 Antibody

Images

 
Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human liver.
Immunohistochemistry: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Independent Antibodies: Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human kidney.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Rpn2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rpn2 Protein (NBP2-38323PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rpn2 Antibody

  • 26S proteasome non-ATPase regulatory subunit 1
  • 26S proteasome regulatory subunit RPN2
  • 26S proteasome regulatory subunit S1
  • 26S proteasome subunit p112
  • MGC133040
  • MGC133041
  • P112
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
  • Rpn2
  • S1

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelmas's syndrome, and Liddle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Rpn2 Antibody (NBP2-38323) (0)

There are no publications for Rpn2 Antibody (NBP2-38323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rpn2 Antibody (NBP2-38323) (0)

There are no reviews for Rpn2 Antibody (NBP2-38323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rpn2 Antibody (NBP2-38323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rpn2 Products

Research Areas for Rpn2 Antibody (NBP2-38323)

Find related products by research area.

Blogs on Rpn2

There are no specific blogs for Rpn2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rpn2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD1
Uniprot