GAL3ST1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GAL3ST1 Antibody [NBP1-85431] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GAL3ST1 Antibody [NBP1-85431] - Staining of human small intestine shows granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAL3ST1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
Specificity
Specificity of human GAL3ST1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAL3ST1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAL3ST1 Protein (NBP1-85431PEP)
Publications
Read Publication using NBP1-85431.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 22114039)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAL3ST1 Antibody

  • 3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase
  • 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase
  • cerebroside (3'-phosphoadenylylsulfate:galactosylceramide 3') sulfotransferase
  • CSTCerebroside sulfotransferase
  • EC 2.8.2.11
  • galactose-3-O-sulfotransferase 1
  • galactosylceramide sulfotransferase
  • GalCer sulfotransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69148
Species: Hu, Rt
Applications: WB, ELISA
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB5826
Species: Hu
Applications: WB, IHC
NBP2-50031
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-FrFl
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NB110-75035
Species: Hu, Mu, Ha(-)
Applications: WB, ICC/IF, IHC, KD, Single-Cell Western
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GAL3ST1 Antibody (NBP1-85431)(1)

Reviews for GAL3ST1 Antibody (NBP1-85431) (0)

There are no reviews for GAL3ST1 Antibody (NBP1-85431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GAL3ST1 Antibody (NBP1-85431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GAL3ST1 Products

Bioinformatics Tool for GAL3ST1 Antibody (NBP1-85431)

Discover related pathways, diseases and genes to GAL3ST1 Antibody (NBP1-85431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAL3ST1 Antibody (NBP1-85431)

Discover more about diseases related to GAL3ST1 Antibody (NBP1-85431).
 

Pathways for GAL3ST1 Antibody (NBP1-85431)

View related products by pathway.

Blogs on GAL3ST1

There are no specific blogs for GAL3ST1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAL3ST1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAL3ST1