GABA-A R delta Antibody - BSA Free

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining in human cerebral cortex and pancreas tissues using anti-GABRD antibody. Corresponding GABRD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining of human cerebral cortex shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GABA-A R delta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 29020412).
• Control Peptide:

  GABA-A R delta Protein (NBP2-33421PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GABA-A R delta Antibody - BSA Free

• EIG10
• EJM7
• GABA A R delta
• GABA(A) receptor subunit delta
• GABA-A receptor, delta polypeptide
• GABAAR delta
• GABAARd
• GABRD
• gamma-aminobutyric acid (GABA) A receptor, delta
• gamma-aminobutyric acid receptor subunit delta
• GEFSP5
• MGC45284

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a channel associated with the GABAA Receptor (GABAA-R) subtype. GABAA-Rs are important therapeutic targets for a range of sedative, anxiolytic, and hypnotic agents and are implicated in several diseases including epilepsy, anxiety, depression, and substance abuse. The GABAA-R is a multimeric subunit complex. To date six as, four bs and four gs, plus alternative splicing variants of some of these subunits, have been identified (Olsen and Tobin, 1990; Whiting et al., 1999; Ogris et al., 2004). Injection in oocytes or mammalian cell lines of cRNA coding for a- and b-subunits results in the expression of functional GABAA-Rs sensitive to GABA. However, coexpression of a g-subunit is required for benzodiazepine modulation. The various effects of the benzodiazepines in brain may also be mediated via different a-subunits of the receptor (McKernan et al., 2000; Mehta and Ticku, 1998; Ogris et al., 2004; P ltl et al., 2003). More recently there have been a number of studies demonstrating that the -subunit of the receptor may affect subunit assembly (Korpi et al., 2002) and may also confer differential sensitivity to neurosteroids and to ethanol (Wallner et al., 2003; Wohlfarth et al., 2002).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GABA-A R delta Antibody (NBP2-33421)(1)

Publication using NBP2-33421

• Gatta E, Auta J, Gavin DP et al. Emerging role of one-carbon metabolism and DNA methylation enrichment on delta-containing GABAA receptor expression in the cerebellum of subjects with alcohol use disorders (AUD) Int J Neuropsychopharmacol 2017-08-19 [PMID: 29020412] (WB, Human)

Bioinformatics

• Gene Symbol: GABRD
• Uniprot:
  • O14764(Human)