Orthogonal Strategies: Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining in human cerebral cortex and pancreas tissues using anti-GABRD antibody. Corresponding GABRD RNA-seq data are ...read more
Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GABA-A R delta Antibody [NBP2-33421] - Staining of human cerebral cortex shows high expression.
Novus Biologicals Rabbit GABA-A R delta Antibody - BSA Free (NBP2-33421) is a polyclonal antibody validated for use in IHC and WB. Anti-GABA-A R delta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for GABA-A R delta Antibody - BSA Free
EIG10
EJM7
GABA A R delta
GABA(A) receptor subunit delta
GABA-A receptor, delta polypeptide
GABAAR delta
GABAARd
GABRD
gamma-aminobutyric acid (GABA) A receptor, delta
gamma-aminobutyric acid receptor subunit delta
GEFSP5
MGC45284
Background
Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a channel associated with the GABAA Receptor (GABAA-R) subtype. GABAA-Rs are important therapeutic targets for a range of sedative, anxiolytic, and hypnotic agents and are implicated in several diseases including epilepsy, anxiety, depression, and substance abuse. The GABAA-R is a multimeric subunit complex. To date six as, four bs and four gs, plus alternative splicing variants of some of these subunits, have been identified (Olsen and Tobin, 1990; Whiting et al., 1999; Ogris et al., 2004). Injection in oocytes or mammalian cell lines of cRNA coding for a- and b-subunits results in the expression of functional GABAA-Rs sensitive to GABA. However, coexpression of a g-subunit is required for benzodiazepine modulation. The various effects of the benzodiazepines in brain may also be mediated via different a-subunits of the receptor (McKernan et al., 2000; Mehta and Ticku, 1998; Ogris et al., 2004; P ltl et al., 2003). More recently there have been a number of studies demonstrating that the -subunit of the receptor may affect subunit assembly (Korpi et al., 2002) and may also confer differential sensitivity to neurosteroids and to ethanol (Wallner et al., 2003; Wohlfarth et al., 2002).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for GABA-A R delta Antibody (NBP2-33421) (0)
There are no reviews for GABA-A R delta Antibody (NBP2-33421).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GABA-A R delta Antibody - BSA Free and receive a gift card or discount.