GIP Antibody

Images

 
Immunohistochemistry-Paraffin: GIP Antibody [NBP1-86422] - Staining of human small intestine shows strong cytoplasmic positivity in a subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GIP Protein (NBP1-86422PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GIP Antibody

  • gastric inhibitory polypeptide
  • GIP
  • Glucose-dependent Insulinotropic Polypeptide
  • Incretin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB8210
Species: Hu
Applications: Flow, IHC, Block, CyTOF-ready
NBP2-49600
Species: Hu
Applications: IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P

Publications for GIP Antibody (NBP1-86422) (0)

There are no publications for GIP Antibody (NBP1-86422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIP Antibody (NBP1-86422) (0)

There are no reviews for GIP Antibody (NBP1-86422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GIP Antibody (NBP1-86422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIP Products

Bioinformatics Tool for GIP Antibody (NBP1-86422)

Discover related pathways, diseases and genes to GIP Antibody (NBP1-86422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIP Antibody (NBP1-86422)

Discover more about diseases related to GIP Antibody (NBP1-86422).
 

Pathways for GIP Antibody (NBP1-86422)

View related products by pathway.

PTMs for GIP Antibody (NBP1-86422)

Learn more about PTMs related to GIP Antibody (NBP1-86422).

Blogs on GIP

There are no specific blogs for GIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIP
Entrez