Prostaglandin E Synthase Antibody - BSA Free

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human seminal vesicle and pancreas tissues. Corresponding Prostaglandin E Synthase RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human seminal vesicle shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human testis shows weak to moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cell line SiHa shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Prostaglandin E Synthase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGES
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Prostaglandin E Synthase Protein (NBP1-87852PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27102561).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Prostaglandin E Synthase Antibody - BSA Free

• EC 5.3.99.3
• MGC10317
• MGST1L1
• MGST1-L1
• MGST1L1MGST1-like 1
• MGST1-L1mPGES-1
• MGST-IV
• Microsomal glutathione S-transferase 1-like 1
• Microsomal prostaglandin E synthase 1
• MPGES
• MPGES1
• MPGES-1
• p53-induced apoptosis protein 12
• p53-induced gene 12 protein
• PGES
• PGESmicrosomal prostaglandin E synthase-1
• PIG12
• PIG12glutathione S-transferase 1-like 1
• PP102
• PP1294
• Prostaglandin E Synthase
• PTGES
• TP53I12
• tumor protein p53 inducible protein 12

Background

Prostaglandin E Synthase is encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prostaglandin E Synthase Antibody (NBP1-87852)(6)

Publications using NBP1-87852

• Toda K, Ueyama M, Tanaka S, et al. Ellagitannins from Punica granatum leaves suppress microsomal prostaglandin E synthase-1 expression and induce lung cancer cells to undergo apoptosis Biosci. Biotechnol. Biochem. 2019-12-22 [PMID: 31868102]
• Kim SH, Roszik J, Cho SN et al. The COX2 effector microsomal PGE2 synthase-1 is a regulator of immunosuppression in cutaneous melanoma Clin. Cancer Res. 2018-12-11 [PMID: 30538110] (IHC-P, Human)
• Yao L, Chen W, Han C, Wu T. Microsomal prostaglandin E synthase-1 (mPGES-1) protects against Fas-induced liver injury. Am. J. Physiol. Gastrointest. Liver Physiol. 2016-04-21 [PMID: 27102561] (IHC-P, Mouse)
• Kim SH, Hashimoto Y, Cho SN et al. Microsomal PGE2 synthase-1 regulates melanoma cell survival and associates with melanoma disease progression. Pigment Cell Melanoma Res. 2016-01-23 [PMID: 26801201] (IHC-P, Human)
• Dilme JF, Solo -Villo D, Bellmunt S et al. Active Smoking Increases Microsomal PGE2-Synthase-1/PGE-Receptor-4 Axis in Human Abdominal Aortic Aneurysms. Mediators Inflamm 2014-01-01 [PMID: 24876670] (IF/IHC, Human)
• Camacho M, Dilme J, Solo -Villo D et al. Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm. J Lipid Res 2013-12-01 [PMID: 24133193] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: PTGES