Prostaglandin E Synthase Antibody

Images

 
Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human placenta shows cytoplasmic positivity in a subset of trophoblastic cells.
Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prostaglandin E Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGES
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Prostaglandin E Synthase Protein (NBP1-87852PEP)
Publications
Read Publications using
NBP1-87852 in the following applications:

  • IHC
    2 publications
  • 2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27102561), Human reactivity reported in scientific literature (PMID: 24133193).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prostaglandin E Synthase Antibody

  • EC 5.3.99.3
  • MGC10317
  • MGST1L1MGST1-like 1
  • MGST1-L1mPGES-1
  • MGST-IV
  • Microsomal glutathione S-transferase 1-like 1
  • Microsomal prostaglandin E synthase 1
  • MPGES
  • MPGES1
  • MPGES-1
  • p53-induced apoptosis protein 12
  • p53-induced gene 12 protein
  • PGESmicrosomal prostaglandin E synthase-1
  • PIG12glutathione S-transferase 1-like 1
  • PP102
  • PP1294
  • prostaglandin E synthase
  • TP53I12
  • tumor protein p53 inducible protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45904
Species: Hu
Applications: WB, IHC, IF
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6656
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87852
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Prostaglandin E Synthase Antibody (NBP1-87852)(4)

Reviews for Prostaglandin E Synthase Antibody (NBP1-87852) (0)

There are no reviews for Prostaglandin E Synthase Antibody (NBP1-87852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Prostaglandin E Synthase Antibody (NBP1-87852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prostaglandin E Synthase Products

Bioinformatics Tool for Prostaglandin E Synthase Antibody (NBP1-87852)

Discover related pathways, diseases and genes to Prostaglandin E Synthase Antibody (NBP1-87852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostaglandin E Synthase Antibody (NBP1-87852)

Discover more about diseases related to Prostaglandin E Synthase Antibody (NBP1-87852).
 

Pathways for Prostaglandin E Synthase Antibody (NBP1-87852)

View related products by pathway.

PTMs for Prostaglandin E Synthase Antibody (NBP1-87852)

Learn more about PTMs related to Prostaglandin E Synthase Antibody (NBP1-87852).

Blogs on Prostaglandin E Synthase

There are no specific blogs for Prostaglandin E Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostaglandin E Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGES