Prostaglandin E Synthase Antibody

Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining in human seminal vesicle and endometrium tissues using anti-PTGES antibody. Corresponding PTGES RNA-seq data are presented for the same tissues.

Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human cell line A-549.

Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human seminal vesicle shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Prostaglandin E Synthase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
• Specificity: Specificity of human, mouse Prostaglandin E Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGES
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  Prostaglandin E Synthase Lysate (NBP2-65162)

• Control Peptide:

  Prostaglandin E Synthase Protein (NBP1-87852PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27102561), Human reactivity reported in scientific literature (PMID: 24133193).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Prostaglandin E Synthase Antibody

• EC 5.3.99.3
• MGC10317
• MGST1L1MGST1-like 1
• MGST1-L1mPGES-1
• MGST-IV
• Microsomal glutathione S-transferase 1-like 1
• Microsomal prostaglandin E synthase 1
• MPGES
• MPGES1
• MPGES-1
• p53-induced apoptosis protein 12
• p53-induced gene 12 protein
• PGESmicrosomal prostaglandin E synthase-1
• PIG12glutathione S-transferase 1-like 1
• PP102
• PP1294
• prostaglandin E synthase
• TP53I12
• tumor protein p53 inducible protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prostaglandin E Synthase Antibody (NBP1-87852)(4)

Publications using NBP1-87852

• Yao L, Chen W, Han C, Wu T. Microsomal prostaglandin E synthase-1 (mPGES-1) protects against Fas-induced liver injury. Am. J. Physiol. Gastrointest. Liver Physiol. 2016 Apr 21 [PMID: 27102561] (IHC-P, Mouse)
• Kim SH, Hashimoto Y, Cho SN et al. Microsomal PGE2 synthase-1 regulates melanoma cell survival and associates with melanoma disease progression. Pigment Cell Melanoma Res. 2016 Jan 23 [PMID: 26801201] (IHC-P, Human)
• Dilme JF, Solo -Villo D, Bellmunt S et al. Active Smoking Increases Microsomal PGE2-Synthase-1/PGE-Receptor-4 Axis in Human Abdominal Aortic Aneurysms. Mediators Inflamm 2014 [PMID: 24876670] (IHC, Human)
• Camacho M, Dilme J, Solo -Villo D et al. Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm. J Lipid Res 2013 Dec [PMID: 24133193] (IHC, Human)

Bioinformatics

• Gene Symbol: PTGES