Prostaglandin E Synthase Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human seminal vesicle and pancreas tissues. Corresponding Prostaglandin E Synthase RNA-seq data ...read more
Immunocytochemistry/ Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human seminal vesicle shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human testis shows weak to moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Prostaglandin E Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGES
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Prostaglandin E Synthase Protein (NBP1-87852PEP)
Publications
Read Publications using
NBP1-87852 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27102561).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prostaglandin E Synthase Antibody

  • EC 5.3.99.3
  • MGC10317
  • MGST1L1
  • MGST1-L1
  • MGST1L1MGST1-like 1
  • MGST1-L1mPGES-1
  • MGST-IV
  • Microsomal glutathione S-transferase 1-like 1
  • Microsomal prostaglandin E synthase 1
  • MPGES
  • MPGES1
  • MPGES-1
  • p53-induced apoptosis protein 12
  • p53-induced gene 12 protein
  • PGES
  • PGESmicrosomal prostaglandin E synthase-1
  • PIG12
  • PIG12glutathione S-transferase 1-like 1
  • PP102
  • PP1294
  • Prostaglandin E Synthase
  • PTGES
  • TP53I12
  • tumor protein p53 inducible protein 12

Background

Prostaglandin E Synthase is encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prostaglandin E Synthase Antibody (NBP1-87852)(6)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IF/IHC, IHC-P.


Filter By Application
IF/IHC
(2)
IHC-P
(3)
All Applications
Filter By Species
Human
(4)
Mouse
(1)
All Species

Reviews for Prostaglandin E Synthase Antibody (NBP1-87852) (0)

There are no reviews for Prostaglandin E Synthase Antibody (NBP1-87852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Prostaglandin E Synthase Antibody (NBP1-87852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prostaglandin E Synthase Products

Blogs on Prostaglandin E Synthase

There are no specific blogs for Prostaglandin E Synthase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostaglandin E Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGES