GBGT1 Antibody

Images

 
Western Blot: GBGT1 Antibody [NBP2-14040] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: GBGT1 Antibody [NBP2-14040] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBGT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPS LKLIRFSTLDKDISCLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBGT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GBGT1 Protein (NBP2-14040PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBGT1 Antibody

  • A3GALNT
  • EC 2.4.1.-
  • Forssman glycolipid synthase-like protein
  • Forssman glycolipid synthetase (FS)
  • Forssman synthetase
  • FSUNQ2513
  • globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
  • MGC44848
  • UDP-GalNAc

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2009
Species: Hu
Applications: WB, IHC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF7895
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for GBGT1 Antibody (NBP2-14040) (0)

There are no publications for GBGT1 Antibody (NBP2-14040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBGT1 Antibody (NBP2-14040) (0)

There are no reviews for GBGT1 Antibody (NBP2-14040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBGT1 Antibody (NBP2-14040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBGT1 Products

GBGT1 NBP2-14040

Bioinformatics Tool for GBGT1 Antibody (NBP2-14040)

Discover related pathways, diseases and genes to GBGT1 Antibody (NBP2-14040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBGT1 Antibody (NBP2-14040)

Discover more about diseases related to GBGT1 Antibody (NBP2-14040).
 

Pathways for GBGT1 Antibody (NBP2-14040)

View related products by pathway.

PTMs for GBGT1 Antibody (NBP2-14040)

Learn more about PTMs related to GBGT1 Antibody (NBP2-14040).

Blogs on GBGT1

There are no specific blogs for GBGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBGT1