Recombinant Human SCN2A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SCN2A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 273-362 of Human SCN2A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCN2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCN2A GST (N-Term) Protein

  • BFIC3
  • brain type 2 alpha subunit
  • EIEE11
  • HBA
  • HBSCI
  • HBSCII
  • Na(v)1.2
  • NAC2
  • Nav1.2
  • SCN2A1HBSC II
  • SCN2A2
  • sodium channel, voltage-gated, type II, alpha 1 polypeptide
  • sodium channel, voltage-gated, type II, alpha 2 polypeptide
  • sodium channel, voltage-gated, type II, alpha subunit
  • voltage-gated sodium channel subtype II
  • Voltage-gated sodium channel subunit alpha Nav1.2

Background

SCN2A2 - sodium channel, voltage-gated, type II, alpha 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58876
Species: Hu
Applications: ICC/IF
NBP2-84177
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-03278
Species: Mu, Rt
Applications: WB
NBP3-09253
Species: Dr
Applications: WB
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12904
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-94559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47615
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NB300-151
Species: Hu, Mu, Rt, Tr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-12898
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCN2A Partial Recombinant Protein (H00006326-Q01) (0)

There are no publications for SCN2A Partial Recombinant Protein (H00006326-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN2A Partial Recombinant Protein (H00006326-Q01) (0)

There are no reviews for SCN2A Partial Recombinant Protein (H00006326-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCN2A Partial Recombinant Protein (H00006326-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SCN2A Products

Array H00006326-Q01

Bioinformatics Tool for SCN2A Partial Recombinant Protein (H00006326-Q01)

Discover related pathways, diseases and genes to SCN2A Partial Recombinant Protein (H00006326-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCN2A Partial Recombinant Protein (H00006326-Q01)

Discover more about diseases related to SCN2A Partial Recombinant Protein (H00006326-Q01).
 

Pathways for SCN2A Partial Recombinant Protein (H00006326-Q01)

View related products by pathway.

PTMs for SCN2A Partial Recombinant Protein (H00006326-Q01)

Learn more about PTMs related to SCN2A Partial Recombinant Protein (H00006326-Q01).

Blogs on SCN2A

There are no specific blogs for SCN2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCN2A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN2A