![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0005.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Fumarylacetoacetate hydrolase Antibody - BSA Free (NBP2-48807) is a polyclonal antibody validated for use in IHC and WB. Anti-Fumarylacetoacetate hydrolase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYT |
| Predicted Species | Mouse (92%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
| Publication using NBP2-48807 | Applications | Species |
|---|---|---|
| Guo R, Sun X, Wang F et Al. Engineered IscB-?RNA system with improved base editing efficiency for disease correction via single AAV delivery in mice Cell Rep 2024-11-13 [PMID: 39541214] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAH |
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-FAH antibody NBP2-48807 (A) shows similar protein distribution across tissues to independent antibody NBP2-48736 (B).](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0006.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-FAH antibody NBP2-48807 (A) shows similar protein distribution across tissues to independent antibody NBP2-48736 (B).")
![Western Blot: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Analysis using Anti-FAH antibody NBP2-48807 (A) shows similar pattern to independent antibody NBP2-48736 (B).](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Western-Blot-NBP2-48807-img0007.jpg "Western Blot: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Analysis using Anti-FAH antibody NBP2-48807 (A) shows similar pattern to independent antibody NBP2-48736 (B).")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human pancreas using Anti-FAH antibody NBP2-48807.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0011.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human pancreas using Anti-FAH antibody NBP2-48807.")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0003.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0004.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0008.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human testis.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0009.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human liver using Anti-FAH antibody NBP2-48807.](http://images.novusbio.com/fullsize/Fumarylacetoacetate-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP2-48807-img0010.jpg "Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human liver using Anti-FAH antibody NBP2-48807.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")