Fumarylacetoacetate hydrolase Antibody

Images

 
Western Blot: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48807] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fumarylacetoacetate hydrolase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYT
Specificity
Specificity of human Fumarylacetoacetate hydrolase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fumarylacetoacetate hydrolase Recombinant Protein Antigen (NBP2-48807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fumarylacetoacetate hydrolase Antibody

  • beta-diketonase
  • EC 3.7.1.2
  • FAA
  • fumarylacetoacetase
  • fumarylacetoacetate hydrolase (fumarylacetoacetase)
  • Fumarylacetoacetate hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NB100-2564
Species: Hu
Applications: WB
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-89158
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-33488
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Fumarylacetoacetate hydrolase Antibody (NBP2-48807) (0)

There are no publications for Fumarylacetoacetate hydrolase Antibody (NBP2-48807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fumarylacetoacetate hydrolase Antibody (NBP2-48807) (0)

There are no reviews for Fumarylacetoacetate hydrolase Antibody (NBP2-48807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fumarylacetoacetate hydrolase Antibody (NBP2-48807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)

Discover related pathways, diseases and genes to Fumarylacetoacetate hydrolase Antibody (NBP2-48807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)

Discover more about diseases related to Fumarylacetoacetate hydrolase Antibody (NBP2-48807).
 

Pathways for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)

View related products by pathway.

PTMs for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)

Learn more about PTMs related to Fumarylacetoacetate hydrolase Antibody (NBP2-48807).
 

Research Areas for Fumarylacetoacetate hydrolase Antibody (NBP2-48807)

Find related products by research area.

Blogs on Fumarylacetoacetate hydrolase

There are no specific blogs for Fumarylacetoacetate hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fumarylacetoacetate hydrolase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAH