ALAD Antibody

Images

 
Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Orthogonal Strategies: Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining in human adrenal gland and pancreas tissues using anti-ALAD antibody. Corresponding ALAD RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human pancreas shows low expression as expected.
Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ALAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
ALAD Protein (NBP1-89158PEP)
Publications
Read Publication using
NBP1-89158 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28857503).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALAD Antibody

  • ALADHEC 4.2.1.24
  • aminolevulinate dehydratase
  • aminolevulinate, delta-, dehydratase
  • delta-aminolevulinic acid dehydratase
  • PBGSMGC5057
  • Porphobilinogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-54863
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-26190
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-56415
Species: Hu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-89158
Species: Hu, Rt, Mu
Applications: WB, Simple Western, IHC, IHC-P

Publications for ALAD Antibody (NBP1-89158)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for ALAD Antibody (NBP1-89158) (0)

There are no reviews for ALAD Antibody (NBP1-89158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALAD Antibody (NBP1-89158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALAD Products

Bioinformatics Tool for ALAD Antibody (NBP1-89158)

Discover related pathways, diseases and genes to ALAD Antibody (NBP1-89158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALAD Antibody (NBP1-89158)

Discover more about diseases related to ALAD Antibody (NBP1-89158).
 

Pathways for ALAD Antibody (NBP1-89158)

View related products by pathway.

PTMs for ALAD Antibody (NBP1-89158)

Learn more about PTMs related to ALAD Antibody (NBP1-89158).

Blogs on ALAD

There are no specific blogs for ALAD, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALAD