ALAD Antibody

Images

 
Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.
Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Simple Western 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
ALAD Protein (NBP1-89158PEP)
Publications
Read Publication using
NBP1-89158 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALAD Antibody

  • ALADHEC 4.2.1.24
  • aminolevulinate dehydratase
  • aminolevulinate, delta-, dehydratase
  • delta-aminolevulinic acid dehydratase
  • PBGSMGC5057
  • Porphobilinogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for ALAD Antibody (NBP1-89158)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for ALAD Antibody (NBP1-89158) (0)

There are no reviews for ALAD Antibody (NBP1-89158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALAD Antibody (NBP1-89158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALAD Products

Bioinformatics Tool for ALAD Antibody (NBP1-89158)

Discover related pathways, diseases and genes to ALAD Antibody (NBP1-89158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALAD Antibody (NBP1-89158)

Discover more about diseases related to ALAD Antibody (NBP1-89158).
 

Pathways for ALAD Antibody (NBP1-89158)

View related products by pathway.

PTMs for ALAD Antibody (NBP1-89158)

Learn more about PTMs related to ALAD Antibody (NBP1-89158).

Blogs on ALAD

There are no specific blogs for ALAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALAD