FANCC Antibody (6E7)

Images

 
Western Blot: FANCC Antibody (6E7) [H00002176-M01] - Analysis of FANCC expression in transfected 293T cell line by FANCC monoclonal antibody (M01), clone 6E7.Lane 1: FANCC transfected lysate(63.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: FANCC Antibody (6E7) [H00002176-M01] - Analysis of monoclonal antibody to FANCC on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FANCC Antibody (6E7) Summary

Immunogen
FANCC (NP_000127, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINK
Specificity
FANCC - Fanconi anemia, complementation group C
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FANCC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00002176-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FANCC Antibody (6E7)

  • FA Complementation Group C
  • FA3
  • FACC
  • FACCProtein FACC
  • FACFanconi anemia group C protein
  • FANCC
  • Fanconi anemia, complementation group C
  • FLJ14675

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group C.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2564
Species: Hu
Applications: WB
H00002189-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00002188-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-49878
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-48736
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DFS00
Species: Hu
Applications: ELISA
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP2-81908
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for FANCC Antibody (H00002176-M01) (0)

There are no publications for FANCC Antibody (H00002176-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FANCC Antibody (H00002176-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002176-M01:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Verified Customer
Western Blot Human 06/21/2010
View

Summary

ApplicationWestern Blot
Sample TestedHeLa whole cell lysate, Sample Amount: 30 ug
SpeciesHuman
Lot7236-6E7-00KcY6

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FANCC Antibody (H00002176-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FANCC Products

Bioinformatics Tool for FANCC Antibody (H00002176-M01)

Discover related pathways, diseases and genes to FANCC Antibody (H00002176-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCC Antibody (H00002176-M01)

Discover more about diseases related to FANCC Antibody (H00002176-M01).
 

Pathways for FANCC Antibody (H00002176-M01)

View related products by pathway.

PTMs for FANCC Antibody (H00002176-M01)

Learn more about PTMs related to FANCC Antibody (H00002176-M01).
 

Research Areas for FANCC Antibody (H00002176-M01)

Find related products by research area.

Blogs on FANCC.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Verified Customer
06/21/2010
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol FANCC
Entrez
OMIM
Uniprot