Fumarylacetoacetate hydrolase Antibody


Western Blot: Fumarylacetoacetate hydrolase Antibody [NBP1-53110] - Jurkat cell lysate, concentration 2.5 ug/ml.
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP1-53110] - Human Liver and Mouse FAH KO liver. Primary Dilution: 1:400
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP1-53110] - Human liver.
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP1-53110] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP1-53110] - Human liver, mouse KO tissue.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Fumarylacetoacetate hydrolase Antibody Summary

Synthetic peptides corresponding to FAH(fumarylacetoacetate hydrolase (fumarylacetoacetase)) The peptide sequence was selected from the C terminal of FAH. Peptide sequence AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FAH and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fumarylacetoacetate hydrolase Antibody

  • beta-diketonase
  • EC
  • FAA
  • fumarylacetoacetase
  • fumarylacetoacetate hydrolase (fumarylacetoacetase)
  • Fumarylacetoacetate hydrolase


FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO

Publications for Fumarylacetoacetate hydrolase Antibody (NBP1-53110) (0)

There are no publications for Fumarylacetoacetate hydrolase Antibody (NBP1-53110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fumarylacetoacetate hydrolase Antibody (NBP1-53110) (0)

There are no reviews for Fumarylacetoacetate hydrolase Antibody (NBP1-53110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fumarylacetoacetate hydrolase Antibody (NBP1-53110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Fumarylacetoacetate hydrolase Products

Bioinformatics Tool for Fumarylacetoacetate hydrolase Antibody (NBP1-53110)

Discover related pathways, diseases and genes to Fumarylacetoacetate hydrolase Antibody (NBP1-53110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fumarylacetoacetate hydrolase Antibody (NBP1-53110)

Discover more about diseases related to Fumarylacetoacetate hydrolase Antibody (NBP1-53110).

Pathways for Fumarylacetoacetate hydrolase Antibody (NBP1-53110)

View related products by pathway.

PTMs for Fumarylacetoacetate hydrolase Antibody (NBP1-53110)

Learn more about PTMs related to Fumarylacetoacetate hydrolase Antibody (NBP1-53110).

Research Areas for Fumarylacetoacetate hydrolase Antibody (NBP1-53110)

Find related products by research area.

Blogs on Fumarylacetoacetate hydrolase

There are no specific blogs for Fumarylacetoacetate hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fumarylacetoacetate hydrolase Antibody and receive a gift card or discount.


Gene Symbol FAH