Follistatin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Follistatin Source: E.coli
Amino Acid Sequence: LCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPIS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
FST |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21237. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Follistatin Recombinant Protein Antigen
Background
FST, also known as Follistatin, has a 344 amino acid long isoform that is 38 kDa and a short 317 amino acid that is 35 kDa, functions as an activin antagonist binding directly to it and inhibits the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH). Studies of this protein are being performed in relation to polycystic ovary syndrome, pituitary adenoma, insulin resistance, Down syndrome, plasmacytoma, lymphocytic leukemia, pituitary tumor infertility, endometrial carcinoma, teratocarcinoma, azoospermia, meningitis, hepatocellular carcinoma, ovarian carcinoma, liver disease, endometriosis, prostate carcinoma, prostatitis, ovarian cancer, and adenoma. This protein has been also shown to have interactions with ANG, DIP2A, BMP4, FN1, and TXN in signal transduction activin A signaling regulation and TGF-beta signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: AC
Publications for Follistatin Recombinant Protein Antigen (NBP3-21237PEP) (0)
There are no publications for Follistatin Recombinant Protein Antigen (NBP3-21237PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Follistatin Recombinant Protein Antigen (NBP3-21237PEP) (0)
There are no reviews for Follistatin Recombinant Protein Antigen (NBP3-21237PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Follistatin Recombinant Protein Antigen (NBP3-21237PEP) (0)
Additional Follistatin Products
Research Areas for Follistatin Recombinant Protein Antigen (NBP3-21237PEP)
Find related products by research area.
|
Blogs on Follistatin