FIH-1/HIF-1AN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FIH-1/HIF-1AN Antibody [NBP2-58365] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FIH-1/HIF-1AN Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQE
Specificity
Specificity of human FIH-1/HIF-1AN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIF1AN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FIH-1/HIF-1AN Recombinant Protein Antigen (NBP2-58365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FIH-1/HIF-1AN Antibody

  • DKFZp762F1811
  • EC 1.14.11.16
  • factor inhibiting HIF1
  • Factor inhibiting HIF-1
  • FIH1
  • FIH-1
  • FIH1FIH-1
  • FLJ20615
  • FLJ22027
  • HIF1AN
  • HIF-1AN
  • hypoxia inducible factor 1, alpha subunit inhibitor
  • hypoxia-inducible factor 1-alpha inhibitor
  • Hypoxia-inducible factor asparagine hydroxylase
  • Peptide-aspartate beta-dioxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
NB100-381
Species: Hu
Applications: WB, ChIP, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF6394
Species: Hu
Applications: WB, IP
AF5689
Species: Hu
Applications: WB
NBP2-67415
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Re, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PAGE, Dual ISH-IHC, KD, KO

Publications for FIH-1/HIF-1AN Antibody (NBP2-58365) (0)

There are no publications for FIH-1/HIF-1AN Antibody (NBP2-58365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIH-1/HIF-1AN Antibody (NBP2-58365) (0)

There are no reviews for FIH-1/HIF-1AN Antibody (NBP2-58365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FIH-1/HIF-1AN Antibody (NBP2-58365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FIH-1/HIF-1AN Products

Bioinformatics Tool for FIH-1/HIF-1AN Antibody (NBP2-58365)

Discover related pathways, diseases and genes to FIH-1/HIF-1AN Antibody (NBP2-58365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIH-1/HIF-1AN Antibody (NBP2-58365)

Discover more about diseases related to FIH-1/HIF-1AN Antibody (NBP2-58365).
 

Pathways for FIH-1/HIF-1AN Antibody (NBP2-58365)

View related products by pathway.

PTMs for FIH-1/HIF-1AN Antibody (NBP2-58365)

Learn more about PTMs related to FIH-1/HIF-1AN Antibody (NBP2-58365).
 

Research Areas for FIH-1/HIF-1AN Antibody (NBP2-58365)

Find related products by research area.

Blogs on FIH-1/HIF-1AN

There are no specific blogs for FIH-1/HIF-1AN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FIH-1/HIF-1AN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIF1AN