FIH-1/HIF-1AN Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FIH-1/HIF-1AN Antibody - BSA Free (NBP2-54749) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids: YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI |
| Predicted Species |
Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HIF1AN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control |
|
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FIH-1/HIF-1AN Antibody - BSA Free
Background
Factor Inhibiting HIF1 (FIH) protein facilitates repression of HIF-1 transcriptional activity by binding to VHL, which acts as a transcriptional corepressor. VHL inhibits HIF-1 alpha transactivation function by recruiting histone deacetylases. Involvement of VHL in association with FIH provides a unifying mechanism for the modulation of HIF-1 alpha protein stabilization and transcriptional activation in response to changes in cellular oxygen concentration.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu
Applications: ChIP, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for FIH-1/HIF-1AN Antibody (NBP2-54749) (0)
There are no publications for FIH-1/HIF-1AN Antibody (NBP2-54749).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FIH-1/HIF-1AN Antibody (NBP2-54749) (0)
There are no reviews for FIH-1/HIF-1AN Antibody (NBP2-54749).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FIH-1/HIF-1AN Antibody (NBP2-54749) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional FIH-1/HIF-1AN Products
Research Areas for FIH-1/HIF-1AN Antibody (NBP2-54749)
Find related products by research area.
|
Blogs on FIH-1/HIF-1AN