FIH-1/HIF-1AN Antibody - BSA Free

Immunohistochemistry-Paraffin: FIH-1/HIF-1AN Antibody [NBP2-54749] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: FIH-1/HIF-1AN Antibody [NBP2-54749] - Staining of human testis shows strong nuclear and cytoplasmic positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: FIH-1/HIF-1AN Antibody [NBP2-54749] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: FIH-1/HIF-1AN Antibody [NBP2-54749] - Staining in human testis and liver tissues using anti-HIF1AN antibody. Corresponding HIF1AN RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FIH-1/HIF-1AN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FIH-1/HIF-1AN Antibody - BSA Free (NBP2-54749) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIF1AN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control:

  HIF-1 alpha Knockout CoCl2-treated/untreated HeLa Cell Lysate
  HIF-1 alpha Knockout Hypoxic-treated/untreated HeLa Cell Lysate

• Control Peptide:

  FIH-1/HIF-1AN Recombinant Protein Antigen (NBP2-54749PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FIH-1/HIF-1AN Antibody - BSA Free

• DKFZp762F1811
• EC 1.14.11.16
• factor inhibiting HIF1
• Factor inhibiting HIF-1
• FIH1
• FIH-1
• FIH1FIH-1
• FLJ20615
• FLJ22027
• HIF1AN
• HIF-1AN
• hypoxia inducible factor 1, alpha subunit inhibitor
• hypoxia-inducible factor 1-alpha inhibitor
• Hypoxia-inducible factor asparagine hydroxylase
• Peptide-aspartate beta-dioxygenase

Background

Factor Inhibiting HIF1 (FIH) protein facilitates repression of HIF-1 transcriptional activity by binding to VHL, which acts as a transcriptional corepressor. VHL inhibits HIF-1 alpha transactivation function by recruiting histone deacetylases. Involvement of VHL in association with FIH provides a unifying mechanism for the modulation of HIF-1 alpha protein stabilization and transcriptional activation in response to changes in cellular oxygen concentration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HIF1AN