Ficolin-1 Antibody

Images

 
Western Blot: Ficolin-1 Antibody [NBP1-84706] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow, gastrointestinal, lymphoid tissues and pancreas using Anti-FCN1 antibody NBP1-84706 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Analysis in human bone marrow and pancreas tissues using NBP1-84706 antibody. Corresponding FCN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ficolin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
Specificity
Specificity of human Ficolin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ficolin-1 Protein (NBP1-84706PEP)
Publications
Read Publications using NBP1-84706.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ficolin-1 Antibody

  • Collagen/fibrinogen domain-containing protein 1
  • FCN1
  • Fcna
  • FCNM
  • FCNMficolin-A
  • ficolin (collagen/fibrinogen domain containing) 1
  • ficolin (collagen/fibrinogen domain-containing) 1
  • Ficolin1
  • Ficolin-1
  • Ficolin-A
  • ficolin-alpha
  • M-ficolin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2428
Species: Hu
Applications: WB
NBP1-58986
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87492
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-96910
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84706
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ficolin-1 Antibody (NBP1-84706)(2)

Reviews for Ficolin-1 Antibody (NBP1-84706) (0)

There are no reviews for Ficolin-1 Antibody (NBP1-84706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-1 Antibody (NBP1-84706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ficolin-1 Products

Bioinformatics Tool for Ficolin-1 Antibody (NBP1-84706)

Discover related pathways, diseases and genes to Ficolin-1 Antibody (NBP1-84706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-1 Antibody (NBP1-84706)

Discover more about diseases related to Ficolin-1 Antibody (NBP1-84706).
 

Pathways for Ficolin-1 Antibody (NBP1-84706)

View related products by pathway.

PTMs for Ficolin-1 Antibody (NBP1-84706)

Learn more about PTMs related to Ficolin-1 Antibody (NBP1-84706).

Blogs on Ficolin-1

There are no specific blogs for Ficolin-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ficolin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCN1