FGF-8 Antibody - BSA Free

Western Blot: FGF-8 Antibody [NBP1-98443] - Host: Mouse. Target Name: FGF8. Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml

Western Blot: FGF-8 Antibody [NBP1-98443] - PANC1 Cell Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FGF-8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is FGF8 - middle region. Peptide sequence LIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FGF-8 Antibody - BSA Free

• AIGF
• AIGFKAL6
• Androgen-induced growth factor
• FGF8
• FGF-8
• fibroblast growth factor 8 (androgen-induced)
• fibroblast growth factor 8
• HBGF-8
• Heparin-binding growth factor 8
• MGC149376

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FGF-8 Antibody (NBP1-98443). (Showing 1 - 1 of 1 FAQ).

1. We are working on fgf8 signaling in zebrafish and we would like to use fgf8 antibody for IHC but we are not sure whether it will work on fish because the antibody I found on your website is for mammalian system, not fish. So, I would like to know whether you have some information for usage on fish or you can kindly provide to test on zebrafish?
   • The immunogen for NBP1-98443 shares 80% similarity with zebrafish, and as a polyclonal antibody, it should cross-react. This is currently our only antibody that is predicted to cross-react with zebrafish, although it hasn't been tested for this and is not guaranteed. If you would like to test this antibody in zebrafish for IHC, then I can recommend you our Innovator's Reward program. Our Innovator's Reward program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product. Reviews may also be submitted by emailing innovators@novusbio.com.

Bioinformatics

• Gene Symbol: FGF8
• Uniprot:
  • NP_149354()