FGF-10 Antibody (3C7)

Images

 
Proximity Ligation Assay: FGF-10 Antibody (3C7) [H00002255-M05] - Analysis of protein-protein interactions between FGFR2 and FGF10. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGF-10 Antibody (3C7) Summary

Immunogen
FGF10 (NP_004456, 38 a.a. - 137 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKK
Specificity
FGF10 (3C7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGF10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-10 Antibody (3C7)

  • FGF10
  • FGF-10
  • fibroblast growth factor 10
  • Keratinocyte growth factor 2
  • KGF-2
  • produced by fibroblasts of urinary bladder lamina propria

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
H00010253-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FGF-10 Antibody (H00002255-M05) (0)

There are no publications for FGF-10 Antibody (H00002255-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-10 Antibody (H00002255-M05) (0)

There are no reviews for FGF-10 Antibody (H00002255-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-10 Antibody (H00002255-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-10 Products

Bioinformatics Tool for FGF-10 Antibody (H00002255-M05)

Discover related pathways, diseases and genes to FGF-10 Antibody (H00002255-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-10 Antibody (H00002255-M05)

Discover more about diseases related to FGF-10 Antibody (H00002255-M05).
 

Pathways for FGF-10 Antibody (H00002255-M05)

View related products by pathway.

PTMs for FGF-10 Antibody (H00002255-M05)

Learn more about PTMs related to FGF-10 Antibody (H00002255-M05).
 

Research Areas for FGF-10 Antibody (H00002255-M05)

Find related products by research area.

Blogs on FGF-10

There are no specific blogs for FGF-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-10 Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF10
Entrez
OMIM
Uniprot