FATP1/SLC27A1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FATP1/SLC27A1 Antibody [NBP2-69016] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FATP1/SLC27A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FATP1/SLC27A1 Antibody - BSA Free (NBP2-69016) is a polyclonal antibody validated for use in ICC/IF. Anti-FATP1/SLC27A1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC27A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  FATP1/SLC27A1 Recombinant Protein Antigen (NBP2-69016PEP)

Reactivity Notes

Mouse 80%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for FATP1/SLC27A1 Antibody - BSA Free

• ACSVL5FATP-1
• EC 6.2.1
• EC 6.2.1.-
• FATP1
• FATP1Solute carrier family 27 member 1
• FATPlong-chain fatty acid transport protein 1
• Fatty acid transport protein 1
• FLJ00336
• MGC71751
• SLC27A1
• solute carrier family 27 (fatty acid transporter), member 1

Background

SLC27A1 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. The LFCA importappears to be hormone-regulated in a tissue-specific manner. In adipocytes, but not myocytes, insulin induces a rapidtranslocation of FATP1 from intracel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FATP1/SLC27A1 Antibody (NBP2-69016)(1)

Publication using NBP2-69016

• R Peeters, J Cuenca-Esc, EA Zaal, AT Hoekstra, ACG Balvert, M Vidal-Manr, N Blomberg, SJ van Devent, R Stienstra, J Jellusova, M Giera, L Hannibal, U Spiekerkoe, M Ter Beest, CR Berkers, AB van Spriel Fatty acid metabolism in aggressive B-cell lymphoma is inhibited by tetraspanin CD37 Nature Communications, 2022-09-13;13(1):5371. 2022-09-13 [PMID: 36100608]

Bioinformatics

• Gene Symbol: SLC27A1