FATP1/SLC27A1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FATP1/SLC27A1 Antibody - BSA Free (NBP2-69016) is a polyclonal antibody validated for use in ICC/IF. Anti-FATP1/SLC27A1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC27A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FATP1/SLC27A1 Antibody - BSA Free
Background
SLC27A1 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. The LFCA importappears to be hormone-regulated in a tissue-specific manner. In adipocytes, but not myocytes, insulin induces a rapidtranslocation of FATP1 from intracel
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF
Publications for FATP1/SLC27A1 Antibody (NBP2-69016)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP2-69016 |
Applications |
Species |
| R Peeters, J Cuenca-Esc, EA Zaal, AT Hoekstra, ACG Balvert, M Vidal-Manr, N Blomberg, SJ van Devent, R Stienstra, J Jellusova, M Giera, L Hannibal, U Spiekerkoe, M Ter Beest, CR Berkers, AB van Spriel Fatty acid metabolism in aggressive B-cell lymphoma is inhibited by tetraspanin CD37 Nature Communications, 2022-09-13;13(1):5371. 2022-09-13 [PMID: 36100608] |
|
|
Reviews for FATP1/SLC27A1 Antibody (NBP2-69016) (0)
There are no reviews for FATP1/SLC27A1 Antibody (NBP2-69016).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FATP1/SLC27A1 Antibody (NBP2-69016) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FATP1/SLC27A1 Products
Blogs on FATP1/SLC27A1