Novus Biologicals products are now on bio-techne.com

ACSL1 Antibody

Images

 
Independent Antibodies: Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Analysis in human liver and tonsil tissues. Corresponding ACSL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human soft tissues shows moderate to strong cytoplasmic positivity in adipocytes.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACSL1 Protein (NBP1-89270PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89270 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSL1 Antibody

  • ACS1LACS 2
  • Acyl-CoA synthetase 1
  • acyl-CoA synthetase long-chain family member 1
  • EC 6.2.1
  • FACL1EC 6.2.1.3
  • fatty-acid-Coenzyme A ligase, long-chain 1
  • LACS 1
  • LACSlong-chain 2
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 1
  • Long-chain acyl-CoA synthetase 2
  • Long-chain fatty acid-CoA ligase 2
  • long-chain fatty-acid-coenzyme A ligase 1
  • long-chain-fatty-acid--CoA ligase 1
  • Palmitoyl-CoA ligase 1
  • Palmitoyl-CoA ligase 2
  • paltimoyl-CoA ligase 1

Background

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15253
Species: Mu, Rt
Applications: WB
NBP1-92089
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-15252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-81909
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-05516
Species: Hu
Applications: IHC, IHC-P
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-89270
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for ACSL1 Antibody (NBP1-89270) (0)

There are no publications for ACSL1 Antibody (NBP1-89270).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ACSL1 Antibody (NBP1-89270) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-89270:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen ACSL1 NBP1-89270
Enlarge
3
reviewed by:
Verified Customer
IHC-Fr Rat 12/22/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedbrain tissue (hippocampus)
SpeciesRat
LotA40997

Comments

CommentsName: S100A10 antibody
Catalog #: NBP1-89370
Lot Number: A40997
Antibody Storage Conditions:-20℃
Application Tested: IHC-Fr
Staining Expectations: co-labell A2 astrocytes with gfap
Observation & Concerns: The background is very deep and the A2 astrocyte can’t be stained.
Test Sample Information:
Species & Treatments: SD rats & infrasound models
Tissue: brain tissue (hippocampus)
Fixative Composition: 4% paraformaldehyde solution
Fixation Time & Temperature: 6 h or longer
Tissue Processing: antigen retrieval, EDTA pH9.0, 95C, 15min


Blocking Procedure:
Blocking Solution: 3%BSA/5%BSA
Time & Temperature: 0.5 or 1 h & room temperature
Blocking Time: Click here to enter text.
Primary Antibody
Dilution: 1:25; 1:50; 1:100; 1:200; 1:500
Diluent Buffer: 3%BSA,0.3%Triton
Time & Temperature: 12 h & 4℃
Washing Conditions:
Wash Buffer Composition: 1 * PBS
Method (Immersion, Rinsing etc.): Immersion
Times/Washing: 3 * 10 min
Repetitions: 3 times
Secondary Antibody
Manufacturer and Catalog #: CWBIO & CW0114S
Secondary description: anti-rabbit secondary antibody is available, see section controls and additional images.
Dilution: 1:200
Diluent Buffer: 1 * PBS(hoechest, PH=7.4)
Incubation Time & Temperature: 2 h & room temperature
Post-Secondary Washing: the same as post-primary washing
Detection Method:
Detection: DM4000


Controls:
Positive Control: the anti-rabbit secondary antibody is available
Negative Control: the production can not co-labell A2 ast

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACSL1 Antibody (NBP1-89270) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSL1 Products

Array NBP1-89270

Research Areas for ACSL1 Antibody (NBP1-89270)

Find related products by research area.

Blogs on ACSL1.

Immune Cell Metabolic Flux Influences Type I Diabetes
By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Verified Customer
12/22/2017
Application: IHC-Fr
Species: Rat

Bioinformatics

Gene Symbol ACSL1
Entrez
Uniprot