FATP4/SLC27A4 Antibody - BSA Free

Western Blot: FATP4/SLC27A4 Antibody [NBP3-05510] - Analysis in human cell line MCF-7.

Immunocytochemistry/Immunofluorescence: FATP4/SLC27A4 Antibody [NBP3-05510] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: FATP4/SLC27A4 Antibody [NBP3-05510] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FATP4/SLC27A4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC27A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation permeabilization use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, containing 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FATP4/SLC27A4 Antibody - BSA Free

• ACSVL4
• ACSVL4Solute carrier family 27 member 4
• EC 6.2.1
• EC 6.2.1.-
• EC 6.2.1.7
• FATP4
• FATP-4
• FATP4Fatty acid transport protein 4
• IPS
• long-chain fatty acid transport protein 4
• SLC27A4
• solute carrier family 27 (fatty acid transporter), member 4

Background

SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC27A4