FATP2/SLC27A2 Antibody

Images

 
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and pancreas tissues using Anti-SLC27A2 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and skeletal muscle tissues using NBP3-05516 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FATP2/SLC27A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC27A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FATP2/SLC27A2 Antibody

  • ACSVL1
  • ACSVL1FATP-2
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.3
  • EC 6.2.1.7
  • FACVL1
  • FACVL1very long-chain fatty-acid-coenzyme A ligase 1
  • FATP2
  • FATP2THCA-CoA ligase
  • Fatty acid transport protein 2
  • Fatty-acid-coenzyme A ligase, very long-chain 1
  • hFACVL1
  • HsT17226
  • Long-chain-fatty-acid--CoA ligase
  • SLC27A2
  • solute carrier family 27 (fatty acid transporter), member 2
  • Solute carrier family 27 member 2
  • THCA-CoA ligase
  • very-long-chain acyl-CoA synthetase
  • VLACS
  • VLACSVery long-chain-fatty-acid-CoA ligase
  • VLCS
  • VLCSvery long-chain acyl-CoA synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
NBP3-05510
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP3-05511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37412
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02554
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84565
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89265
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for FATP2/SLC27A2 Antibody (NBP3-05516) (0)

There are no publications for FATP2/SLC27A2 Antibody (NBP3-05516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP2/SLC27A2 Antibody (NBP3-05516) (0)

There are no reviews for FATP2/SLC27A2 Antibody (NBP3-05516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FATP2/SLC27A2 Antibody (NBP3-05516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FATP2/SLC27A2 Products

Bioinformatics Tool for FATP2/SLC27A2 Antibody (NBP3-05516)

Discover related pathways, diseases and genes to FATP2/SLC27A2 Antibody (NBP3-05516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FATP2/SLC27A2 Antibody (NBP3-05516)

Discover more about diseases related to FATP2/SLC27A2 Antibody (NBP3-05516).
 

Pathways for FATP2/SLC27A2 Antibody (NBP3-05516)

View related products by pathway.

PTMs for FATP2/SLC27A2 Antibody (NBP3-05516)

Learn more about PTMs related to FATP2/SLC27A2 Antibody (NBP3-05516).

Blogs on FATP2/SLC27A2

There are no specific blogs for FATP2/SLC27A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FATP2/SLC27A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC27A2