FAM58A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM58A Antibody [NBP2-14001] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and golgi apparatus.
Immunohistochemistry-Paraffin: FAM58A Antibody [NBP2-14001] - Staining of human stomach, lower shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM58A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM58A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM58A Protein (NBP2-14001PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM58A Antibody

  • cyclin M
  • cyclin-M
  • cyclin-related protein FAM58A
  • family with sequence similarity 58, member A
  • MGC29729
  • STAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-87178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-84774
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14001
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FAM58A Antibody (NBP2-14001) (0)

There are no publications for FAM58A Antibody (NBP2-14001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM58A Antibody (NBP2-14001) (0)

There are no reviews for FAM58A Antibody (NBP2-14001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM58A Antibody (NBP2-14001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM58A Products

Bioinformatics Tool for FAM58A Antibody (NBP2-14001)

Discover related pathways, diseases and genes to FAM58A Antibody (NBP2-14001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM58A Antibody (NBP2-14001)

Discover more about diseases related to FAM58A Antibody (NBP2-14001).

Blogs on FAM58A

There are no specific blogs for FAM58A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM58A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM58A