QKI/Quaking Antibody (1D1N6)

Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Western blot analysis of extracts of various cell lines, using QKI/Quaking antibody (NBP3-15255) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug QKI/Quaking antibody (NBP3-15255). Western blot was performed from the immunoprecipitate using QKI/Quaking antibody (NBP3-15255) at a dilition of 1:1000.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded mouse kidney tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human tonsil tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human thyroid tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded rat kidney tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded Human lung adenocarcinoma tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded mouse liver tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunofluorescence analysis of NIH/3T3 cells using QKI/Quaking Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human breast cancer tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 1D1N6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

QKI/Quaking Antibody (1D1N6) Summary

• Description: Novus Biologicals Rabbit QKI/Quaking Antibody (1D1N6) (NBP3-15255) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI/Quaking (Q96PU8). RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: QKI
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for QKI/Quaking Antibody (1D1N6)

• DKFZp586I0923
• HKQ
• homolog of mouse quaking QKI (KH domain RNA binding protein)
• Hqk
• hqkI
• protein quaking
• QK
• QK1
• QK3
• quaking homolog, KH domain RNA binding (mouse)
• RNA binding protein HQK

Background

QKI belongs to a family of RNA-binding proteins that have an HNRNPK (MIM 600712) homology (KH) domain embedded in a 200-amino acid region called the GSG domain. Other members of this family include SAM68 (KHDRBS1; MIM 602489) and SF1 (MIM 601516) (Chen and Richard, 1998).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: QKI