FAM3B Antibody

Images

 
Western Blot: FAM3B Antibody [NBP1-89395] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FAM3B Antibody [NBP1-89395] - Staining of human small intestine shows strong cytoplasmic positivity with dot like pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM3B Protein (NBP1-89395PEP)
Publications
Read Publication using NBP1-89395.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM3B Antibody

  • 2-21
  • C21orf11
  • C21orf76PANDER
  • chromosome 21 open reading frame 11
  • Cytokine-like protein 2-21
  • D21M16SJHU19e
  • FAM3B
  • family with sequence similarity 3, member B
  • ORF9
  • pancreatic derived factor
  • Pancreatic-derived factor
  • PANDER
  • PRED44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF

Publications for FAM3B Antibody (NBP1-89395)(1)


Reviews for FAM3B Antibody (NBP1-89395) (0)

There are no reviews for FAM3B Antibody (NBP1-89395). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM3B Antibody (NBP1-89395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM3B Products

Bioinformatics Tool for FAM3B Antibody (NBP1-89395)

Discover related pathways, diseases and genes to FAM3B Antibody (NBP1-89395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3B Antibody (NBP1-89395)

Discover more about diseases related to FAM3B Antibody (NBP1-89395).
 

Pathways for FAM3B Antibody (NBP1-89395)

View related products by pathway.

PTMs for FAM3B Antibody (NBP1-89395)

Learn more about PTMs related to FAM3B Antibody (NBP1-89395).
 

Research Areas for FAM3B Antibody (NBP1-89395)

Find related products by research area.

Blogs on FAM3B

There are no specific blogs for FAM3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3B
Entrez