SLC26A4 Antibody

Western Blot: SLC26A4 Antibody [NBP1-60106] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106] - Human placenta tissue at an antibody concentration of 5ug/ml.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC26A4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC26A4(solute carrier family 26, member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC26A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SLC26A4 and was validated on Western blot.
• Theoretical MW: 86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC26A4 Antibody

• DFNB4
• EVA
• PDSTDH2B
• pendrin
• Sodium-independent chloride/iodide transporter
• Solute carrier family 26 member 4
• solute carrier family 26, member 4

Background

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC26A4 Antibody (NBP1-60106)(5)

Publications using NBP1-60106

• Wu T, Cui L, Mou Y et al. A newly identified mutation (c.2029 C - T) in SLC26A4 gene is associated with enlarged vestibular aqueducts in a Chinese family BMC medical genomics Mar 6 2022 [PMID: 35249537] (WB, Human)
• Berg P, Svendsen SL, Sorensen MV et al. Impaired Renal HCO3- Excretion in Cystic Fibrosis J. Am. Soc. Nephrol. Jul 23 2020 [PMID: 32703846]
• Rehman T, Thornell IM, Pezzulo AA et al. TNFalpha and IL-17 Alkalinize Airway Surface Liquid through CFTR and Pendrin Am. J. Physiol., Cell Physiol. May 20 2020 [PMID: 32432926] (IHC-P, Human)
• Nordstrom CK, Danckwardt-Lilliestrom N, Liu W, Rask-Andersen H Reversed polarizationof Na/K-ATPase-a sign of inverted transport in the human endolymphatic sac: a super-resolution structured illumination microscopy (SR-SIM) study Cell Tissue Res. Nov 12 2019 [PMID: 31713726]
• Jia CE, Jiang D, Dai H et al. Pendrin, an anion exchanger on lung epithelial cells, could be a novel target for lipopolysaccharide-induced acute lung injury mice. Am J Transl Res 2016 Feb 15 [PMID: 27158384] (WB)

FAQs for SLC26A4 Antibody (NBP1-60106). (Showing 1 - 1 of 1 FAQs).

1. I used NBP1-60106 antibody and found bands around 30kDa like the WB result in the datasheet. The MW of this protein should be 86kDa, so I want to know what the 30kDa band is. I checked UniProt http://www.uniprot.org/uniprot/O43511, this protein does have a isoform, but the MW of isoform 2 is 39kDa. Would you please help on this?
   • You are right that human SLC26A4 has two isoforms: isoform 1: 780 a.a. with mass (Da):85,723 and isoform 2: 349 a.a. mass (Da):39,267. But, according to "http://www.uniprot.org/uniprot/O43511#sequences", this protein contains 12 transmembrane domains and should be treated very carefully when preparing lysates. There are two suggestions I have come by for these kind of membrane proteins: (1), use 1% SDS (instead of 0.1%) in the RIPA buffer and/or (2) don't boil but use room temperature for 30 min after adding SDS sample buffer, before loading to the SDS-PAGE. The multiple bands around both isoforms 1 and 2 are likely to be derived from the complexes that were still associated with lipid moieties of the membranes. Furthermore, try to test with cell lines, rather than directly on the tissue samples, as cell lines will usually have less complexity on the isoform expression patterns.

Bioinformatics

• Gene Symbol: SLC26A4
• Uniprot:
  • O43511(Human)