Synthetic peptides corresponding to SLC26A4(solute carrier family 26, member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (92%), Canine (100%), Equine (93%), Bovine (92%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
This is a rabbit polyclonal antibody against SLC26A4 and was validated on Western blot.
Theoretical MW
86 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-60106 in the following applications:
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC26A4 Antibody
DFNB4
EVA
PDSTDH2B
pendrin
Sodium-independent chloride/iodide transporter
Solute carrier family 26 member 4
solute carrier family 26, member 4
Background
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the S
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for SLC26A4 Antibody (NBP1-60106). (Showing 1 - 1 of 1 FAQs).
I used NBP1-60106 antibody and found bands around 30kDa like the WB result in the datasheet. The MW of this protein should be 86kDa, so I want to know what the 30kDa band is. I checked UniProt http://www.uniprot.org/uniprot/O43511, this protein does have a isoform, but the MW of isoform 2 is 39kDa. Would you please help on this?
You are right that human SLC26A4 has two isoforms: isoform 1: 780 a.a. with mass (Da):85,723 and isoform 2: 349 a.a. mass (Da):39,267. But, according to "http://www.uniprot.org/uniprot/O43511#sequences", this protein contains 12 transmembrane domains and should be treated very carefully when preparing lysates. There are two suggestions I have come by for these kind of membrane proteins: (1), use 1% SDS (instead of 0.1%) in the RIPA buffer and/or (2) don't boil but use room temperature for 30 min after adding SDS sample buffer, before loading to the SDS-PAGE. The multiple bands around both isoforms 1 and 2 are likely to be derived from the complexes that were still associated with lipid moieties of the membranes. Furthermore, try to test with cell lines, rather than directly on the tissue samples, as cell lines will usually have less complexity on the isoform expression patterns.
Bioinformatics Tool for SLC26A4 Antibody (NBP1-60106)
Discover related pathways, diseases and genes to SLC26A4 Antibody (NBP1-60106). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SLC26A4 Antibody (NBP1-60106)
Discover more about diseases related to SLC26A4 Antibody (NBP1-60106).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLC26A4 Antibody and receive a gift card or discount.