SLC26A4 Antibody

Images

 
Western Blot: SLC26A4 Antibody [NBP1-60106] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106] - Human placenta tissue at an antibody concentration of 5ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC26A4(solute carrier family 26, member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (92%), Canine (100%), Equine (93%), Bovine (92%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC26A4 and was validated on Western blot.
Theoretical MW
86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-60106 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC26A4 Antibody

  • DFNB4
  • EVA
  • PDSTDH2B
  • pendrin
  • Sodium-independent chloride/iodide transporter
  • Solute carrier family 26 member 4
  • solute carrier family 26, member 4

Background

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-97765
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84450
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IHC-WhMt
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-47273
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04922
Species: Hu
Applications: WB, ICC/IF

Publications for SLC26A4 Antibody (NBP1-60106)(4)

Reviews for SLC26A4 Antibody (NBP1-60106) (0)

There are no reviews for SLC26A4 Antibody (NBP1-60106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A4 Antibody (NBP1-60106). (Showing 1 - 1 of 1 FAQs).

  1. I used NBP1-60106 antibody and found bands around 30kDa like the WB result in the datasheet. The MW of this protein should be 86kDa, so I want to know what the 30kDa band is. I checked UniProt http://www.uniprot.org/uniprot/O43511, this protein does have a isoform, but the MW of isoform 2 is 39kDa. Would you please help on this?
    • You are right that human SLC26A4 has two isoforms: isoform 1: 780 a.a. with mass (Da):85,723 and isoform 2: 349 a.a. mass (Da):39,267. But, according to "http://www.uniprot.org/uniprot/O43511#sequences", this protein contains 12 transmembrane domains and should be treated very carefully when preparing lysates. There are two suggestions I have come by for these kind of membrane proteins: (1), use 1% SDS (instead of 0.1%) in the RIPA buffer and/or (2) don't boil but use room temperature for 30 min after adding SDS sample buffer, before loading to the SDS-PAGE. The multiple bands around both isoforms 1 and 2 are likely to be derived from the complexes that were still associated with lipid moieties of the membranes. Furthermore, try to test with cell lines, rather than directly on the tissue samples, as cell lines will usually have less complexity on the isoform expression patterns.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC26A4 Products

Bioinformatics Tool for SLC26A4 Antibody (NBP1-60106)

Discover related pathways, diseases and genes to SLC26A4 Antibody (NBP1-60106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A4 Antibody (NBP1-60106)

Discover more about diseases related to SLC26A4 Antibody (NBP1-60106).
 

Pathways for SLC26A4 Antibody (NBP1-60106)

View related products by pathway.

PTMs for SLC26A4 Antibody (NBP1-60106)

Learn more about PTMs related to SLC26A4 Antibody (NBP1-60106).

Blogs on SLC26A4

There are no specific blogs for SLC26A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A4
Uniprot