FAM126A Antibody

Images

 
Western Blot: FAM126A Antibody [NBP1-79800] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM126A Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human FAM126AThe immunogen for this antibody is FAM126A. Peptide sequence MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM126A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FAM126A and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM126A Antibody

  • Down-regulated by CTNNB1 protein A
  • DRCTNNB1Aa
  • family with sequence similarity 126, member A
  • HLD5
  • hyccin
  • Protein FAM126A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Av-Du, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-79800
Species: Hu
Applications: WB

Publications for FAM126A Antibody (NBP1-79800) (0)

There are no publications for FAM126A Antibody (NBP1-79800).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM126A Antibody (NBP1-79800) (0)

There are no reviews for FAM126A Antibody (NBP1-79800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM126A Antibody (NBP1-79800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM126A Products

Bioinformatics Tool for FAM126A Antibody (NBP1-79800)

Discover related pathways, diseases and genes to FAM126A Antibody (NBP1-79800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM126A Antibody (NBP1-79800)

Discover more about diseases related to FAM126A Antibody (NBP1-79800).
 

Pathways for FAM126A Antibody (NBP1-79800)

View related products by pathway.

Research Areas for FAM126A Antibody (NBP1-79800)

Find related products by research area.

Blogs on FAM126A

There are no specific blogs for FAM126A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM126A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM126A
Uniprot