FABP2/I-FABP Antibody

Images

 
Western Blot: FABP2/I-FABP Antibody [NBP1-87696] - Analysis in control (vector only transfected HEK293T lysate) and FABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining in human small intestine and liver tissues using anti-FABP2 antibody. Corresponding FABP2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FABP2/I-FABP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FABP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FABP2/I-FABP Protein (NBP1-87696PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FABP2/I-FABP Antibody

  • FABP2
  • FABPI
  • fatty acid binding protein 2, intestinal
  • Fatty acid-binding protein 2
  • fatty acid-binding protein, intestinal
  • IFABP
  • I-FABP
  • I-FABPMGC133132
  • Intestinal FABP
  • Intestinal-type fatty acid-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-87695
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF1476
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MAB1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
AF3880
Species: Hu
Applications: ICC, WB
DCRP00
Species: Hu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-92734
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no publications for FABP2/I-FABP Antibody (NBP1-87696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no reviews for FABP2/I-FABP Antibody (NBP1-87696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP2/I-FABP Products

Bioinformatics Tool for FABP2/I-FABP Antibody (NBP1-87696)

Discover related pathways, diseases and genes to FABP2/I-FABP Antibody (NBP1-87696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP2/I-FABP Antibody (NBP1-87696)

Discover more about diseases related to FABP2/I-FABP Antibody (NBP1-87696).
 

Pathways for FABP2/I-FABP Antibody (NBP1-87696)

View related products by pathway.

PTMs for FABP2/I-FABP Antibody (NBP1-87696)

Learn more about PTMs related to FABP2/I-FABP Antibody (NBP1-87696).
 

Research Areas for FABP2/I-FABP Antibody (NBP1-87696)

Find related products by research area.

Blogs on FABP2/I-FABP

There are no specific blogs for FABP2/I-FABP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP2/I-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP2