FABP2/I-FABP Antibody


Western Blot: FABP2/I-FABP Antibody [NBP1-87696] - Analysis in control (vector only transfected HEK293T lysate) and FABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining in human small intestine and liver tissues using anti-FABP2 antibody. Corresponding FABP2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC
Validated by:

Orthogonal Strategies


Order Details

FABP2/I-FABP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FABP2/I-FABP Protein (NBP1-87696PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FABP2/I-FABP Antibody

  • FABP2
  • fatty acid binding protein 2, intestinal
  • Fatty acid-binding protein 2
  • fatty acid-binding protein, intestinal
  • I-FABP
  • I-FABPMGC133132
  • Intestinal FABP
  • Intestinal-type fatty acid-binding protein


The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Dr, Hu, Mu
Applications: WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no publications for FABP2/I-FABP Antibody (NBP1-87696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no reviews for FABP2/I-FABP Antibody (NBP1-87696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP2/I-FABP Antibody (NBP1-87696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FABP2/I-FABP Products

Diseases for FABP2/I-FABP Antibody (NBP1-87696)

Discover more about diseases related to FABP2/I-FABP Antibody (NBP1-87696).

Pathways for FABP2/I-FABP Antibody (NBP1-87696)

View related products by pathway.

PTMs for FABP2/I-FABP Antibody (NBP1-87696)

Learn more about PTMs related to FABP2/I-FABP Antibody (NBP1-87696).

Research Areas for FABP2/I-FABP Antibody (NBP1-87696)

Find related products by research area.

Blogs on FABP2/I-FABP

There are no specific blogs for FABP2/I-FABP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FABP2/I-FABP Antibody and receive a gift card or discount.


Gene Symbol FABP2