Apolipoprotein CIII Antibody - Azide and BSA Free

Western Blot: Apolipoprotein CIII Antibody [NBP2-92734] - Analysis of extracts of various cell lines, using Apolipoprotein C3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Rat spleen using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Human liver using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Mouse spleen using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: Apolipoprotein CIII Antibody [NBP2-92734] - Analysis of HepG2 cells using Apolipoprotein C3 Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] - Immunofluorescence analysis of paraffin-embedded rat liver using Apolipoprotein CIII Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] - Immunofluorescence analysis of paraffin-embedded mouse liver using Apolipoprotein CIII Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Apolipoprotein CIII Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Apolipoprotein CIII Antibody - Azide and BSA Free (NBP2-92734) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1). MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Apolipoprotein CIII Antibody - Azide and BSA Free

• APOC3
• APOCIII
• apo-CIII
• apoC-III
• Apolipoprotein C3
• apolipoprotein C-III
• MGC150353

Background

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOC3