FABP1/L-FABP Antibody

Images

 
Western Blot: FABP1/L-FABP Antibody [NBP1-87695] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunocytochemistry/ Immunofluorescence: FABP1/L-FABP Antibody [NBP1-87695] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: FABP1/L-FABP Antibody [NBP1-87695] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: FABP1/L-FABP Antibody [NBP1-87695] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FABP1/L-FABP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FABP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FABP1/L-FABP Protein (NBP1-87695PEP)
Publications
Read Publications using NBP1-87695.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FABP1/L-FABP Antibody

  • FABP1
  • FABPL
  • fatty acid binding protein 1, liver
  • fatty acid-binding protein, liver
  • LFABP
  • L-FABP
  • L-FABPFatty acid-binding protein 1
  • Liver-type fatty acid-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF1857
Species: Mu
Applications: WB, Simple Western, IP
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF2009
Species: Hu
Applications: WB, IHC
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FABP1/L-FABP Antibody (NBP1-87695)(2)

Reviews for FABP1/L-FABP Antibody (NBP1-87695) (0)

There are no reviews for FABP1/L-FABP Antibody (NBP1-87695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FABP1/L-FABP Antibody (NBP1-87695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP1/L-FABP Products

Bioinformatics Tool for FABP1/L-FABP Antibody (NBP1-87695)

Discover related pathways, diseases and genes to FABP1/L-FABP Antibody (NBP1-87695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP1/L-FABP Antibody (NBP1-87695)

Discover more about diseases related to FABP1/L-FABP Antibody (NBP1-87695).
 

Pathways for FABP1/L-FABP Antibody (NBP1-87695)

View related products by pathway.

PTMs for FABP1/L-FABP Antibody (NBP1-87695)

Learn more about PTMs related to FABP1/L-FABP Antibody (NBP1-87695).
 

Research Areas for FABP1/L-FABP Antibody (NBP1-87695)

Find related products by research area.

Blogs on FABP1/L-FABP

There are no specific blogs for FABP1/L-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP1/L-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP1
Entrez