F-box protein 15/FBXO15 Antibody - BSA Free

Western Blot: F-box protein 15/FBXO15 Antibody [NBP1-56901] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Western Blot: F-box protein 15/FBXO15 Antibody [NBP1-56901] - 293T cells lysate at 1:500.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

F-box protein 15/FBXO15 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for F-box protein 15/FBXO15 Antibody - BSA Free

• F-box only protein 15
• Fbox protein 15
• F-box protein 15
• FBX15
• FBX15MGC39671
• FBXO15

Background

FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO15
• Uniprot:
  • Q8NCQ5(Human)