EWSR1 Antibody

Images

 
Western Blot: EWSR1 Antibody [NBP2-49020] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody [NBP2-49020] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human skin.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining in human testis and skeletal muscle tissues using anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human colon, liver, skin and testis using Anti-EWSR1 antibody NBP2-49020 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human liver.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49020] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EWSR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGG
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EWSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EWSR1 Recombinant Protein Antigen (NBP2-49020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EWSR1 Antibody

  • bK984G1.4
  • Ewing sarcoma breakpoint region 1 protein
  • Ewing sarcoma breakpoint region 1
  • Ewings sarcoma EWS-Fli1 (type 1) oncogene
  • EWS oncogene
  • EWSRNA-binding protein EWS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-16500
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3968
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38747
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP1-92685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PP-H7833-00
Species: Hu
Applications: IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
212-GD/CF
Species: Hu
Applications: Bind, BA
H00006883-M11
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP2-49020
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EWSR1 Antibody (NBP2-49020) (0)

There are no publications for EWSR1 Antibody (NBP2-49020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EWSR1 Antibody (NBP2-49020) (0)

There are no reviews for EWSR1 Antibody (NBP2-49020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EWSR1 Antibody (NBP2-49020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EWSR1 Products

Bioinformatics Tool for EWSR1 Antibody (NBP2-49020)

Discover related pathways, diseases and genes to EWSR1 Antibody (NBP2-49020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EWSR1 Antibody (NBP2-49020)

Discover more about diseases related to EWSR1 Antibody (NBP2-49020).
 

Pathways for EWSR1 Antibody (NBP2-49020)

View related products by pathway.

PTMs for EWSR1 Antibody (NBP2-49020)

Learn more about PTMs related to EWSR1 Antibody (NBP2-49020).
 

Research Areas for EWSR1 Antibody (NBP2-49020)

Find related products by research area.

Blogs on EWSR1

There are no specific blogs for EWSR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EWSR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EWSR1