Kv11.1 Antibody - Azide and BSA Free

Western Blot: Kv11.1 Antibody [NBP3-03109] - Analysis of extracts of various cell lines, using Kv11.1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhan

Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Human lung cancer using KCNH2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - human breast cancer using KCNH2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Human colon carcinoma using KCNH2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kv11.1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNH2 (NP_000229.1). DHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Kv11.1 Antibody - Azide and BSA Free

• Eag homolog
• Eag-related protein 1
• ERG
• ERG1
• ERG-1
• Ether-a-go-go-related gene potassium channel 1
• ether-a-go-go-related potassium channel protein
• Ether-a-go-go-related protein 1
• HERG
• H-ERG
• hERG1
• hERG-1
• HERGhERG-1
• KCNH2
• Kv11.1
• LQT2
• potassium voltage-gated channel subfamily H member 2
• potassium voltage-gated channel, subfamily H (eag-related), member 2
• SQT1
• Voltage-gated potassium channel subunit Kv11.1

Background

Human ether-a-go-go related gene (HERG) encodes the pore-forming subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants of HERG include the full-length isoform 1 alpha and the shorter isoform 1 beta. Isoform 1 beta lacks the PAS motif and deactivates at a faster rate than isoform 1alpha. Residues within the C-terminal play a role in channel expression and channel gating, including voltage-dependent activation. HERG is expressed in the heart and is more abundantly expressed in the ventricles than in the atria. Mutations in the gene encoding HERG increase beat-to-beat variability and early after depolarization. These fluctuations facilitate the genesis and propagation of premature heartbeats associated with inheritable long QT syndrome type 2 and short QT syndrome type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNH2