TAF12 Antibody (1E10)

Images

 
Western Blot: TAF12 Antibody (1E10) [H00006883-M11] - Analysis of TAF12 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: TAF12 Antibody (1E10) [H00006883-M11] - Analysis of monoclonal antibody to TAF12 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: TAF12 Antibody (1E10) [H00006883-M11] - Detection limit for recombinant GST tagged TAF12 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAF12 Antibody (1E10) Summary

Immunogen
TAF12 (AAH11986, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Specificity
TAF12 - TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa (1E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAF12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF12 Antibody (1E10)

  • 20kDa
  • TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF15
  • TAF2J
  • TAFII-20/TAFII-15
  • TAFII20TAFII20/TAFII15
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD
  • Transcription initiation factor TFIID 20/15 kDa subunits
  • transcription initiation factor TFIID subunit 12

Background

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-16389
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-95183
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PP-H7833-00
Species: Hu
Applications: IP, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP1-86675
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
MAB6519
Species: Hu, Mu
Applications: IHC, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-24750
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
212-GD/CF
Species: Hu
Applications: Bind, BA
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
NBP1-86971
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82774
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00006883-M11
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for TAF12 Antibody (H00006883-M11) (0)

There are no publications for TAF12 Antibody (H00006883-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF12 Antibody (H00006883-M11) (0)

There are no reviews for TAF12 Antibody (H00006883-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF12 Antibody (H00006883-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAF12 Products

Bioinformatics Tool for TAF12 Antibody (H00006883-M11)

Discover related pathways, diseases and genes to TAF12 Antibody (H00006883-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF12 Antibody (H00006883-M11)

Discover more about diseases related to TAF12 Antibody (H00006883-M11).
 

Pathways for TAF12 Antibody (H00006883-M11)

View related products by pathway.

PTMs for TAF12 Antibody (H00006883-M11)

Learn more about PTMs related to TAF12 Antibody (H00006883-M11).

Blogs on TAF12

There are no specific blogs for TAF12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF12 Antibody (1E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF12
Entrez
Uniprot